KEGG   Danio rerio (zebrafish): 562943Help
Entry
562943            CDS       T01004                                 

Definition
novel protein similar to H.sapiens EEA1, early endosome antigen 1 (EEA1)
Orthology
K12478  
early endosome antigen 1
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    562943
   04145 Phagosome
    562943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
18
AA seq 1398 aa AA seqDB search
MLRRILQMTPGKGGSQSSESEQPSADMNNESSEGFICPQCMKSHNSAEELFKHYEVFHEP
GDQPSPFSPGREDLTLLRQEIQDLQASLKEERWFSEELKKELDKVQGRIATNKGLQSDGT
SGEDAELEMRLNESETEKFNIKQMKDLFEQKAAQLATEIVDIKSRYDEEKSMREALEQRL
ANLNQDMQKEKQEKEKLSAELLQRPGVEDVEVLKKELVQVQTLMDNMTREREEESERLKG
QYEQLQANFTTSEKTIAQLKAELEKGPQEAAVYTQQIHQLQSSLNNLQQQSQALSEKLSR
KEKENQELEERLGHEQASKKSLQANLHQKELELQESRARVSSGEAALSRAQAELTERGEE
AARLRRELGELEKNQQELKAERKQLQQQREDKENQGLQQQSEISQLHAKLLEAERQVGEL
QGRLKEQRQLSGEKLKDREQQAADLQLKLSRLEEELKESSTKSTDLQHQLDKSKQQHQEL
QTLQQSTNGKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKESVSQLETEREDLCAKI
QAGEGEAALLNQLQEKNHSLQEQITQLTDKLKNQSESHKQAQDNLHEQVQEQKTHLRSAQ
DRCQGLETTVTELNTQLTESREKIAQLDTQLKAKTEMLLSAEAAKNAQRADLESHLETAQ
NALQDKQQELSKVQAQLEEQARRLTEKQEQCSQLENGLKDSRDKLMTAEQRIETLQTQTK
KAEVELTELRSGREQAQKEQSSLKKQISELEMKTKELNRLLDSEKQGASTQQEELKKKSS
ALTETRQKLEKAEQERGALQANLDKLSQEGQKQQAELDKKVQGLSSDLQKTQGEKETLVK
EVATVKEALSKASKALKESQTQLDKEKKGSKATLEEKEKVFQKVQQELQKNSEATSKELS
NVKGLLEKSIEAEKSLQSQLTALNAQLKQCQDTLKEKEKSEQQLQAELKTRQGSFSQEVK
KLKTQVSELQASLAKKTEEEAKQKEQITALSKDLSSEKNRCAELQKTSDGTKESLTALQS
DYYGKESELSAVRQDLKVCEEKLVLAQEELVTNRNQLSAYETQIQELKTGHTAMEIDLSK
RDEKIKQQVETLQKLQKQQGQTEEQLKKEKAQCEELRESQSALEKDKNKLSADLKTLAEK
NEKELKDLQAAKQLLIQQKVEMQGKVEAAQASVEKEQREHQKTRDSIKQNEQQLKAETNK
IKQQLASEVKAKEEMVRQREEAEVKMSMQVTALNENVATLKREWQSSQRRVGELEKQTDE
LRGEIAVLEATVQNNQDERRALLERCVQGEGEMEKLQAKMLEMRRKLDDTTAAMQELGRE
NQSLQIKQSQSLTRKWTEDHEVQNCMACGKGFSVTVRKHHCRHCGNIFCAECSARNALTP
SSKKPVRVCDNCFDELQG
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atgttaagacgaatattacagatgactcctgggaaaggaggctctcagagctcggagtct
gagcagccgtctgctgatatgaataatgagtcctcagagggctttatttgtccccagtgt
atgaaatcccataactctgctgaggagctcttcaaacattatgaggtctttcatgaacca
ggagaccagccgtccccctttagccccggcagggaggatttaacattacttcgacaggaa
atccaagacttacaggcttcactgaaggaggaacgctggttttctgaggaattgaaaaaa
gaattagacaaagtacaaggacgaatagcaactaataaaggcttacagagcgatggtaca
agtggagaagatgcagagcttgagatgagactcaatgaatcggagacagagaagttcaac
atcaaacagatgaaggacctgtttgaacaaaaagctgctcagcttgcgaccgagatagtt
gacatcaaatctcgctacgatgaggagaaaagtatgagagaagctttggagcagagactg
gccaacttaaaccaagatatgcaaaaagaaaaacaggagaaggagaaactgtcggcagag
ctgctccagaggccgggtgtggaagatgtggaggtgttgaagaaagagctggtgcaggtg
cagacgctcatggacaacatgacccgagagcgagaggaggagtcagagcgcctcaaaggc
caatatgagcagctgcaggccaacttcactacctcagagaaaacgattgctcaattaaag
gctgaactggagaagggtcctcaagaagcagcggtttacacacaacagatccaccaatta
cagagcagcttgaacaacctccagcagcaatcccaggctttgtcagagaaattatctcgt
aaagagaaggagaatcaggaactggaggagcgtctgggtcacgaacaggcctctaagaag
agtcttcaggctaatctgcatcagaaagagctggagctccaggagagtcgagcacgggtg
tcttcaggagaagcagctctcagtcgagcacaggctgaattaactgaacgtggggaagag
gctgcacgactcagacgagagctgggcgagctggagaagaaccagcaggagctgaaggca
gagcggaaacaacttcaacagcagagggaggataaagaaaaccagggcctgcagcaacag
agtgagatcagccagctgcatgcgaagctgctggaagcggagcgtcaggtgggggagctg
cagggtcgtctgaaagagcagagacagctgtctggagagaagctcaaagacagagaacag
caggcagcagatctccagctcaaactctcccgcttagaggaagagttgaaggagagctcc
accaagtccactgacctgcagcatcagctggacaaatccaaacagcagcatcaagaacta
caaacacttcaacagagcactaatggcaaacttagagaagcacagaatgacctggagcag
gtgttgcgtcagatcggcgacaaagaccagaagatccagaatcttgaagctctgctccag
aagagtaaggaaagtgtgagccagctggagaccgagagagaggatctgtgtgccaagatt
caggctggagaaggagaagctgctttgctgaaccaattacaagagaaaaatcactcgcta
caagaacagatcacgcagcttacagacaagcttaagaaccagtcggagagccacaagcag
gctcaggacaaccttcatgaacaggtgcaggagcagaagacacacctgcgttcagctcaa
gaccgctgtcagggtctggagaccaccgtcactgaactcaacacacagctcacagagagc
agagagaagatcgctcagctagacactcagttgaaagccaagactgagatgctgttgtct
gctgaagcagcaaaaaatgcccagagagctgacttggagagccacctagagactgctcag
aatgcattgcaggataagcagcaagagctcagtaaagtgcaggctcagctggaggagcag
gcccgcaggctgacggagaagcaggagcagtgctctcagctggagaacggcctgaaggac
agcagagacaaactgatgactgcagaacagaggatagagacgctccagacccagaccaag
aaagccgaggttgagttgactgagctccgctccggaagagaacaggctcagaaagagcag
tcttctcttaagaagcagatcagtgagctggagatgaagaccaaagagttgaaccgactt
ttagattccgagaaacaaggagcttccacccagcaagaggagctaaagaagaaaagctca
gctctcaccgaaacaagacaaaagctggagaaagcagagcaggagcgtggagccctgcag
gccaacctggataaactgtctcaggagggtcagaagcagcaggcagagttggacaagaag
gtgcagggtctgagttcagatctccagaaaactcagggggagaaagaaacgctggtaaaa
gaagtggcgacagtgaaagaggctctgagtaaagcttctaaagccctgaaggagagccag
actcaattagacaaggagaagaagggcagcaaggccactttggaggagaaggaaaaggtt
tttcaaaaagtacaacaagagcttcagaagaactcagaggccacttctaaagagctcagc
aatgtcaaaggtctgctggagaaatcgatagaggcagaaaagagtcttcaatctcagctg
actgcactgaacgctcagctgaagcagtgtcaggatacactgaaggagaaagaaaagagt
gaacagcagctgcaggcagagctgaagaccaggcaaggctccttcagtcaggaagtgaag
aaactgaagacacaggtgtctgagctgcaggcttcccttgctaaaaagactgaagaggaa
gccaagcaaaaggagcaaatcacagcactgtctaaagatctgagctcagagaagaatcgc
tgtgcagagctgcagaaaaccagtgacggcaccaaagagagtctcaccgcccttcagtct
gattactatggcaaagagtctgagctctctgctgtacgccaggaccttaaggtgtgcgag
gagaagttggttcttgctcaggaggagctggtgaccaacaggaaccagctcagtgcttac
gaaacccaaatccaggagctgaagacgggccacacagcgatggagatagacctgagcaag
agagacgagaagatcaaacagcaagtggagactctgcagaagctccagaaacaacaggga
caaacagaggagcagctgaagaaggagaaagctcaatgcgaggagctgagagagagtcaa
agcgccctggaaaaggacaaaaacaaactgtctgctgatctcaaaacactggctgagaag
aatgagaaggagctgaaggacttgcaggcagcaaagcagttgttgatccagcaaaaggtg
gagatgcaggggaaggtagaggcggctcaagcatctgtggagaaagaacagagagagcat
cagaagaccagagactccatcaaacagaatgagcagcagctcaaggctgagaccaacaaa
ataaagcagcagctggcatcagaagtgaaggctaaagaggagatggtgcggcagagggaa
gaggctgaggtgaagatgtccatgcaggtgacggcactgaatgagaacgtggccacgctg
aagcgagagtggcagagcagccagaggcgggtgggtgagctggagaaacagacggatgag
ctgagaggagagattgccgtgctggaagcaacagtccagaacaaccaagacgaaagacgt
gcactacttgagaggtgcgtccagggtgaaggggagatggagaagcttcaggctaagatg
ttggagatgcgcaggaagttggacgacactactgccgccatgcaggagcttggtcgagag
aaccagtccttacagataaaacagtcacaatccctcacacggaagtggacagaagaccat
gaggtgcagaactgcatggcttgtgggaaaggcttctccgtcactgtcagaaagcaccac
tgcagacactgcgggaacatcttctgtgcagagtgctctgcccgcaacgccctcacaccc
tcctccaagaagcccgttcgagtgtgtgacaactgctttgatgagctccagggctga

DBGET integrated database retrieval system