KEGG   Danio rerio (zebrafish): 563023Help
Entry
563023            CDS       T01004                                 

Definition
si:ch211-222g5.4
Orthology
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
23
AA seq 2233 aa AA seqDB search
MADFKCSVTSAAINLADDAPWKKIQKNTFTRWCNEHLRSVNMRISDLKTDLSDGLVLISL
LEVLSHKRMFRKYHTRPTFRQLKLDNVSVALEFLDHEKVKLVSIDSKAIVDGNLKLILGL
VWTLIQHYSISTPVWEDEANDSVSKLTPEMRLLGWIQNKVPELPITNFSQDWQDGKALGA
LVDGLAPGLCPDWESWDSVHRVSNTKEAMQQADDWLGVPQLIAPEEILDPAVDEQSVMTY
LSLFPKARLKPGAPLKPKKVPKPKACRATGRGLQSKGIRVEQLAEFKVDTCRAGPGNLDV
HIRDPSGSEVSVTQKELFKGVFGFQYTPSAEGDHTVDITWVGQHISKSPFKVNVGPEAGP
QKIRVWGPGLEGGTVGSPAQFMVESVGADSGMLGFAIEGPSQAKIACDDHNDGSCQVRFW
PTEAGEYAVHVMCDDEEIQDSPFMASIRPKSKGFHPDKVKVEGPGVSQTGCVINLQNEFI
VDTRQAGEGELAVFAQRADGECVDVTISSEQSGVFVCSYTPSSLSKHTIAVTWGGVMVPG
SPFIVTPRRIKITPCSPVWFKPDGSEICYSDEDFPENVHPGGRGELVMNVISPSNMPADA
TKVNAHGPGLTEGVVGEQAEFIIDTSRAGSGRLDVRVDGPSEVTLQCLDDQDGTCTVLYL
PTEHGMYQINVLFDNSHIPGSPFGANIHHPVDPSKVLVTNSALQHGIVGEPCIVNIDCAK
VGSEDLSVQAISDSGVVVETEVKENEDGTYTVVYVPRTGGVYTLLLKYGGKVLPVHKVMV
EQKVYKSHVKVSRRGGVVVGERETDASQVVASGLGLQKGLIGHPNMFCVNTRSPVDDLGV
TVEGPSDCQVTCKDGGQGVYGVEYTPTVPGEYKISITSGENSIPGSPFVVSVDDVSNTAG
SGDCLQAGICISSNAVTSQEIVKHNGSRMHRASPASLVKDRKPVLDPQSLYGSSSPNQFQ
ALPKYGRDKELSLAHDLNMADIIAPGIKGGICGKTPQGFTISCSSSGESPNAVAVVRPDG
SKEFLELTDNRDGSCSGVYLPTMDGCHSLIVKFPNEESFNRQFQVLPTDELAEVNVSGPG
LTSGMCAQCPQTFIIDCTSSRKTLQFVTMMTPNGISEIMEVRDNGDCTYSVNYTPTMEGL
YSLMVKYTDDDSFCSPFKFQVLPVPGVDYKHPETPVFESGFKADVCVNTPQAFIVDGSSI
GEPPETVALLTPDGKIKLLSSKDNGDGSYLVEYSASAEGPHSIMAKYTNDDCFRSIHRFN
AIPPHTVRKDKDIGNKKENSSQEGNVHSKPPHTFTNGCRVEPEANAKANGSIKLADILDN
RDKKCEMSCTPKMPGCKSVMDKYNSKEAFRSLQTDPTVNTEQSVCAQSPQLFRISCSKSG
KPPDCVLMIRPDGETELTEVKENPDGTYSVKYCPTNEGLHSLMVKYVDDDSFYNPLRFHV
LPHADSHDKHVINTNEACSRQLEERVSAQIPQTFTTCCNTNEASGTEMLKADDHVEVLNN
ENTTSATTHTPEPSAVRNATLEDFQRHQPPSSHTSSGYRGFQNKVEGRNAIPPAAINQAG
FISCDIVLPGDLSEGEITGEVITPSGKRAQPDMIDNKDGTVVMKFDPSEEGLHQILIKSA
ENDIPELPLQYYANSLANRSPVAYGRGLVCGIANETATFTICQEDSASSELDITIEGPSE
ADVHCLDNEDGTCSVSYLPTEPGDYEIQVQHNDVPIPGSPFKAKITDGHMRKSEVKLGSA
VDFTLDITEEDISQLSASIMSPTGNDVPCLLKTQADSHLGISFIPREAGEHLVSIMKDGE
HVSNSPISLSISQAEIGDASKVKAFGPGLHTGHTFCKSEFVVDTWDAGYGGLTVVIEGPS
KVDVHTKELENDGTCNISYCPIKPGSYKISIKFSDEHIPGSPFTAVVKDQGLMRENITYN
QKAAPTASIGSECSLAFKLQDVDPGTMSAHVYEPSGSFGEAVILPSTGRDIYVVSFLAKE
MGVYNVSIQNKGQTISGCPLQYTVGPLGRGGSEKVQVWGQSLQTALATVPADFNIWSREA
GAGALSVSVEGPGEIELLFDEQMDGSCIVTYTAQQPGDYEVSVMFDEDHVSQSPFLVSVI
AATDTAVSDQTQLCNGHGEASLSGPQINTTSDSSAEPVLLSDASKVICHGPGLSKGFLGR
KNTFYVDCSKAGRNLLFVGMHGPTVPCERVSIIHMGQCQYRINYAVKERGKYVLAVKWGD
EHIPGSPFYISVV
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggctgactttaaatgtagcgttacttcagctgcaatcaacctggcagatgatgcacca
tggaagaagatccagaagaacacctttacacgctggtgcaatgaacacctgaggtctgtg
aacatgcggatcagcgatctgaagaccgatctgagcgatggccttgttctcatctctttg
ctggaggtcctgagccacaagaggatgtttagaaagtaccacacgagaccaaccttcagg
caactcaagctggacaatgtttcggtggctctggagtttttggatcatgaaaaggtcaag
ctggtgtctattgacagcaaagcaatagtggatggtaatttgaagctgatcctgggtctg
gtgtggaccctgatacagcattactccatctccaccccagtgtgggaggatgaggcaaac
gattctgtctccaaactgactccagagatgaggcttctgggatggatccaaaacaaagtt
cctgaactgccgatcaccaactttagccaggactggcaggatggcaaggccctcggggca
ttagtggatggacttgcacctggcttgtgtcctgactgggagagctgggactctgtgcat
cgtgtgagcaacactaaagaagcaatgcagcaagctgatgactggcttggggttcctcag
ctcatagccccagaggagattctcgatccagctgtggatgagcagtcggtgatgacatat
ctctcgcttttcccgaaagccagactgaaacctggagcaccgctcaagccaaagaaagtg
cctaaaccaaaagcctgtcgtgccacaggacggggattgcagtccaaaggcataagggta
gaacagctggctgaatttaaggtggacacatgtcgagctgggcctggaaatctggatgtc
catatcagagaccccagtggaagtgaagtgtcggtcacacaaaaggagctgttcaagggt
gtctttggcttccaatatacacccagtgctgaaggagatcacacagtggacattacatgg
gttggtcagcacatttccaagagcccttttaaagtcaatgttggtccagaagcaggacca
cagaagatccgagtgtggggaccgggactagagggaggaactgtgggctcaccggctcag
ttcatggtggaatctgttggtgctgattctggaatgctgggttttgccattgaaggtcca
tctcaggcaaagatcgcttgtgatgaccataatgacggatcctgtcaggtgcgtttctgg
ccgaccgaggcaggtgagtatgcagttcacgtcatgtgtgatgatgaagaaatccaggac
agtccattcatggcctccatcagacccaaaagcaaaggcttccaccctgacaaggtgaaa
gtagaaggaccaggtgtttcccaaactggctgcgtaataaacctccaaaatgaattcatc
gtggataccagacaggctggtgaaggagaacttgcagtttttgctcagagagcagatgga
gagtgtgtcgatgttacaatctcttctgaacaatctggtgtgtttgtctgctcctacacg
ccttcatctctctccaaacacaccattgctgtgacttggggaggcgtcatggttcctggc
agtcctttcattgtgacacctcgcaggattaagattacaccttgtagcccagtctggttt
aaaccagatggatcagaaatttgttactctgatgaagactttccagagaacgtccatcct
ggtggtcgaggagaactggtcatgaatgttatcagcccatcaaatatgccagccgatgcc
acaaaggtaaatgctcatggtcctggactgacagaaggtgttgttggagaacaagcagag
ttcattattgacacaagcagagcaggaagtggaagacttgatgtaagagtagacggaccc
agtgaggttacactacaatgtctggacgatcaagatggcacttgcactgtgctttacctc
cctacggagcatggaatgtaccaaatcaatgtgctttttgacaactctcacattcctgga
tctccgtttggggctaacatacatcatccagttgacccatcgaaagttttggtaactaac
tctgctttgcaacacggaatagtgggtgaaccttgcattgtaaatatagactgtgcaaag
gtaggatctgaggatctatcagtgcaggccatctctgattcaggagttgtcgttgaaacc
gaagtgaaagagaacgaggatggcacatacactgttgtttatgtgccccgaactggaggt
gtatatacactgcttctcaaatatggaggaaaggtgctgcctgttcataaagtgatggtg
gaacagaaggtctacaaaagccatgtaaaagtgagcagaagaggaggcgttgtggttggc
gaaagagaaactgatgcaagccaagttgttgcaagtggtttgggtctccagaaaggcctc
atcggacatcctaacatgttttgtgtaaacaccagatctccagttgatgatcttggtgta
acagtggagggtccgtctgactgtcaggtgacgtgtaaagatggtggtcagggcgtgtat
ggtgtggaatatactccaacagtgcctggtgaatataagatatccataacctctggagag
aacagtattccaggaagcccatttgttgtgtcagtggatgatgtttcaaatactgcaggc
tctggagattgtctacaggctgggatttgcatatcttcaaatgctgttacttctcaagaa
atagtcaaacacaacggatccaggatgcacagagcgagtccagcttcattagtgaaagac
agaaagcccgtcttagatcctcaaagtctttatggaagcagcagtcccaaccagtttcaa
gcactacctaagtatggccgtgataaagagctttccttagctcatgatctgaacatggcc
gatattattgctcctggtattaaaggtggaatctgtggtaaaacccctcaaggcttcaca
attagctgcagcagcagtggagaatctccaaacgcagtggctgtggtgagacctgatgga
tctaaggagttcctggagctcacagacaacagagatggcagttgtagtggtgtctattta
cccaccatggacggttgtcattcattgatagtgaaattccccaatgaagagagttttaat
agacagttccaggtactgccgacagatgaattagccgaggttaatgtatcaggtccaggt
ctaacatcaggaatgtgtgctcagtgtcctcagacattcattatcgactgcacttcctca
agaaaaactctgcagtttgttaccatgatgacaccaaatggcataagtgagataatggag
gtcagagataatggtgactgcacatactctgtgaactacacacctacaatggaaggcctt
tattctttgatggtcaaatatactgatgatgattcattttgcagtcccttcaagtttcaa
gtgctccctgtgcccggtgttgattataaacatcctgaaactccagtttttgaatcaggc
ttcaaggcagatgtgtgtgtgaacactccacaggccttcattgttgatggcagtagcatt
ggagagccaccagagactgtagctctccttactcctgatggcaaaatcaaattattaagt
tcaaaagacaatggagatgggtcatatctagttgagtactccgcttctgctgaaggacct
cactcgatcatggccaaatataccaatgatgattgcttcagaagtattcacaggtttaat
gccattcctcctcacactgtcagaaaggataaagacattggaaataaaaaggaaaattcg
agtcaggagggaaatgtccactctaagcctccacatacattcactaacggctgccgtgtg
gaaccagaagctaatgctaaagctaatggctcaataaaactcgcagatatattggacaac
agggataaaaaatgtgagatgtcttgcacaccaaaaatgccaggctgtaagtctgtaatg
gacaaatacaacagcaaagaagctttcagaagcctccagacagatccgactgtaaataca
gagcaatcagtctgtgctcaaagtcctcagttgttcaggatcagctgtagtaaatccggg
aagccccctgactgtgtgctgatgatcagacctgatggagagactgaactgacagaggtc
aaagaaaaccctgacgggacttactctgtcaaatactgtcccactaatgaaggtcttcat
tccttaatggtcaaatatgttgatgatgattcattttacaatcctttgaggtttcatgtc
cttcctcacgctgatagtcatgacaaacatgtgattaatacaaatgaagcttgtagcaga
caattagaggaacgtgtcagcgctcaaattcctcagactttcacaacttgctgcaacact
aacgaggcctcagggacagagatgttgaaagctgatgatcatgttgaagtgttaaataat
gagaacacaaccagtgcaacaacacacacacctgaaccctcagcggtcagaaatgccaca
ctggaggattttcaaaggcaccagccaccatcctctcacacttcaagtgggtacaggggt
tttcaaaacaaggttgagggcaggaatgcaatccctcctgctgccattaatcaagcaggg
tttatatcctgtgatatagtcctgccaggagacttaagtgaaggtgaaattacaggagag
gtgatcacgccgtctggaaagagagcacagcctgacatgattgataataaagatgggact
gtcgttatgaagtttgatccttcagaggagggtcttcatcaaatccttattaaatcagca
gaaaatgatataccagaacttccactgcaatattatgcaaatagtcttgctaatcgcagc
cctgtggcctatgggcgtggccttgtgtgtggaattgcaaatgagactgcaacattcacc
atctgtcaggaggattcagcctcgagtgaactggacatcacaattgagggtccgtctgag
gctgatgtgcactgcttggacaatgaagatggcacttgttctgtgagttaccttccaact
gagcctggagattatgagatacaagttcaacataatgacgtgcctattccaggcagtcct
ttcaaggccaaaattacagatggacatatgagaaagtcagaggtcaaactgggcagtgcg
gtcgattttaccctggacatcaccgaagaagacattagccagctctccgctagcattatg
tcgcccacaggcaatgatgtaccctgcttactgaaaacacaagctgacagccatctcggc
atctccttcatccccagagaggctggtgagcatctggttagcatcatgaaggatggggag
catgtgagcaacagtcccatctctctgtccatcagtcaggcagagattggagatgccagt
aaggtgaaggccttcggtccaggcttacacaccgggcacaccttctgcaagtctgaattt
gtggtggacacttgggatgcaggatatggtggcttaacagttgtaattgaaggtcccagt
aaagtagacgtccacacaaaagagctggagaatgatggaacttgcaatatatcatactgc
ccaatcaagcctggcagctataaaatctccatcaaattctcagatgagcacattccaggg
agtccgtttacagctgtggtgaaagaccaagggcttatgagagagaacatcacatacaac
cagaaagctgctcctactgccagcattgggagtgaatgcagtttagccttcaaactccaa
gatgttgatcctgggactatgtctgctcatgtatatgaaccatcaggaagttttggagag
gctgttatccttcctagtacaggccgtgacatctatgtagtgagctttctagctaaagag
atgggagtttataatgtgagcatacagaacaaaggccagacgatttccggctgcccactt
caatacaccgtcggcccgctgggacgaggaggatctgagaaggtgcaggtttggggacaa
agccttcagacggctctggcaactgttccagctgactttaatatttggtcgcgtgaggct
ggagcaggggctctttctgtctccgtagagggtcctggagagattgagctcctctttgat
gagcagatggacgggtcttgcattgtgacctatactgcacaacagcctggtgactatgag
gtttcagtcatgtttgatgaggatcatgtttcccaaagcccttttcttgtgtctgtcatt
gccgccacagacactgctgtctctgatcaaactcagctgtgtaacggtcatggagaagcc
tctctgtcaggaccgcagatcaacacaacatctgacagcagtgctgagccagttttgctg
tctgacgctagtaaagtcatctgccacggcccaggcctgagtaagggctttctgggacgc
aaaaacactttttatgtggactgcagtaaagctggacgaaaccttctgttcgtgggcatg
catggccctacagttccctgtgagcgggtgtccatcattcacatgggccagtgtcagtac
aggatcaactacgctgtaaaggaaagaggaaaatatgtcttagcagtgaagtggggagat
gagcacattcctggatcgccgttttatattagtgttgtgtga

DBGET integrated database retrieval system