KEGG   Danio rerio (zebrafish): 563023Help
Entry
563023            CDS       T01004                                 

Gene name
flnb, si:ch211-222g5.4, si:ch211-222g5.6, si:ch211-222g5.7
Definition
(RefSeq) filamin B, beta (actin binding protein 278)
  KO
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563023 (flnb)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    563023 (flnb)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    563023 (flnb)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     563023 (flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    563023 (flnb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   563023 (flnb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
23
AA seq 2233 aa AA seqDB search
MADFKCSVTSAAINLADDAPWKKIQKNTFTRWCNEHLRSVNMRISDLKTDLSDGLVLISL
LEVLSHKRMFRKYHTRPTFRQLKLDNVSVALEFLDHEKVKLVSIDSKAIVDGNLKLILGL
VWTLIQHYSISTPVWEDEANDSVSKLTPEMRLLGWIQNKVPELPITNFSQDWQDGKALGA
LVDGLAPGLCPDWESWDSVHRVSNTKEAMQQADDWLGVPQLIAPEEILDPAVDEQSVMTY
LSLFPKARLKPGAPLKPKKVPKPKACRATGRGLQSKGIRVEQLAEFKVDTCRAGPGNLDV
HIRDPSGSEVSVTQKELFKGVFGFQYTPSAEGDHTVDITWVGQHISKSPFKVNVGPEAGP
QKIRVWGPGLEGGTVGSPAQFMVESVGADSGMLGFAIEGPSQAKIACDDHNDGSCQVRFW
PTEAGEYAVHVMCDDEEIQDSPFMASIRPKSKGFHPDKVKVEGPGVSQTGCVINLQNEFI
VDTRQAGEGELAVFAQRADGECVDVTISSEQSGVFVCSYTPSSLSKHTIAVTWGGVMVPG
SPFIVTPRRIKITPCSPVWFKPDGSEICYSDEDFPENVHPGGRGELVMNVISPSNMPADA
TKVNAHGPGLTEGVVGEQAEFIIDTSRAGSGRLDVRVDGPSEVTLQCLDDQDGTCTVLYL
PTEHGMYQINVLFDNSHIPGSPFGANIHHPVDPSKVLVTNSALQHGIVGEPCIVNIDCAK
VGSEDLSVQAISDSGVVVETEVKENEDGTYTVVYVPRTGGVYTLLLKYGGKVLPVHKVMV
EQKVYKSHVKVSRRGGVVVGERETDASQVVASGLGLQKGLIGHPNMFCVNTRSPVDDLGV
TVEGPSDCQVTCKDGGQGVYGVEYTPTVPGEYKISITSGENSIPGSPFVVSVDDVSNTAG
SGDCLQAGICISSNAVTSQEIVKHNGSRMHRASPASLVKDRKPVLDPQSLYGSSSPNQFQ
ALPKYGRDKELSLAHDLNMADIIAPGIKGGICGKTPQGFTISCSSSGESPNAVAVVRPDG
SKEFLELTDNRDGSCSGVYLPTMDGCHSLIVKFPNEESFNRQFQVLPTDELAEVNVSGPG
LTSGMCAQCPQTFIIDCTSSRKTLQFVTMMTPNGISEIMEVRDNGDCTYSVNYTPTMEGL
YSLMVKYTDDDSFCSPFKFQVLPVPGVDYKHPETPVFESGFKADVCVNTPQAFIVDGSSI
GEPPETVALLTPDGKIKLLSSKDNGDGSYLVEYSASAEGPHSIMAKYTNDDCFRSIHRFN
AIPPHTVRKDKDIGNKKENSSQEGNVHSKPPHTFTNGCRVEPEANAKANGSIKLADILDN
RDKKCEMSCTPKMPGCKSVMDKYNSKEAFRSLQTDPTVNTEQSVCAQSPQLFRISCSKSG
KPPDCVLMIRPDGETELTEVKENPDGTYSVKYCPTNEGLHSLMVKYVDDDSFYNPLRFHV
LPHADSHDKHVINTNEACSRQLEERVSAQIPQTFTTCCNTNEASGTEMLKADDHVEVLNN
ENTTSATTHTPEPSAVRNATLEDFQRHQPPSSHTSSGYRGFQNKVEGRNAIPPAAINQAG
FISCDIVLPGDLSEGEITGEVITPSGKRAQPDMIDNKDGTVVMKFDPSEEGLHQILIKSA
ENDIPELPLQYYANSLANRSPVAYGRGLVCGIANETATFTICQEDSASSELDITIEGPSE
ADVHCLDNEDGTCSVSYLPTEPGDYEIQVQHNDVPIPGSPFKAKITDGHMRKSEVKLGSA
VDFTLDITEEDISQLSASIMSPTGNDVPCLLKTQADSHLGISFIPREAGEHLVSIMKDGE
HVSNSPISLSISQAEIGDASKVKAFGPGLHTGHTFCKSEFVVDTWDAGYGGLTVVIEGPS
KVDVHTKELENDGTCNISYCPIKPGSYKISIKFSDEHIPGSPFTAVVKDQGLMRENITYN
QKAAPTASIGSECSLAFKLQDVDPGTMSAHVYEPSGSFGEAVILPSTGRDIYVVSFLAKE
MGVYNVSIQNKGQTISGCPLQYTVGPLGRGGSEKVQVWGQSLQTALATVPADFNIWSREA
GAGALSVSVEGPGEIELLFDEQMDGSCIVTYTAQQPGDYEVSVMFDEDHVSQSPFLVSVI
AATDTAVSDQTQLCNGHGEASLSGPQINTTSDSSAEPVLLSDASKVICHGPGLSKGFLGR
KNTFYVDCSKAGRNLLFVGMHGPTVPCERVSIIHMGQCQYRINYAVKERGKYVLAVKWGD
EHIPGSPFYISVV
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggctgactttaaatgtagcgttacttcagctgcaatcaacctggcagatgatgcacca
tggaagaagatccagaagaacacctttacacgctggtgcaatgaacacctgaggtctgtg
aacatgcggatcagcgatctgaagaccgatctgagcgatggccttgttctcatctctttg
ctggaggtcctgagccacaagaggatgtttagaaagtaccacacgagaccaaccttcagg
caactcaagctggacaatgtttcggtggctctggagtttttggatcatgaaaaggtcaag
ctggtgtctattgacagcaaagcaatagtggatggtaatttgaagctgatcctgggtctg
gtgtggaccctgatacagcattactccatctccaccccagtgtgggaggatgaggcaaac
gattctgtctccaaactgactccagagatgaggcttctgggatggatccaaaacaaagtt
cctgaactgccgatcaccaactttagccaggactggcaggatggcaaggccctcggggca
ttagtggatggacttgcacctggcttgtgtcctgactgggagagctgggactctgtgcat
cgtgtgagcaacactaaagaagcaatgcagcaagctgatgactggcttggggttcctcag
ctcatagccccagaggagattctcgatccagctgtggatgagcagtcggtgatgacatat
ctctcgcttttcccgaaagccagactgaaacctggagcaccgctcaagccaaagaaagtg
cctaaaccaaaagcctgtcgtgccacaggacggggattgcagtccaaaggcataagggta
gaacagctggctgaatttaaggtggacacatgtcgagctgggcctggaaatctggatgtc
catatcagagaccccagtggaagtgaagtgtcggtcacacaaaaggagctgttcaagggt
gtctttggcttccaatatacacccagtgctgaaggagatcacacagtggacattacatgg
gttggtcagcacatttccaagagcccttttaaagtcaatgttggtccagaagcaggacca
cagaagatccgagtgtggggaccgggactagagggaggaactgtgggctcaccggctcag
ttcatggtggaatctgttggtgctgattctggaatgctgggttttgccattgaaggtcca
tctcaggcaaagatcgcttgtgatgaccataatgacggatcctgtcaggtgcgtttctgg
ccgaccgaggcaggtgagtatgcagttcacgtcatgtgtgatgatgaagaaatccaggac
agtccattcatggcctccatcagacccaaaagcaaaggcttccaccctgacaaggtgaaa
gtagaaggaccaggtgtttcccaaactggctgcgtaataaacctccaaaatgaattcatc
gtggataccagacaggctggtgaaggagaacttgcagtttttgctcagagagcagatgga
gagtgtgtcgatgttacaatctcttctgaacaatctggtgtgtttgtctgctcctacacg
ccttcatctctctccaaacacaccattgctgtgacttggggaggcgtcatggttcctggc
agtcctttcattgtgacacctcgcaggattaagattacaccttgtagcccagtctggttt
aaaccagatggatcagaaatttgttactctgatgaagactttccagagaacgtccatcct
ggtggtcgaggagaactggtcatgaatgttatcagcccatcaaatatgccagccgatgcc
acaaaggtaaatgctcatggtcctggactgacagaaggtgttgttggagaacaagcagag
ttcattattgacacaagcagagcaggaagtggaagacttgatgtaagagtagacggaccc
agtgaggttacactacaatgtctggacgatcaagatggcacttgcactgtgctttacctc
cctacggagcatggaatgtaccaaatcaatgtgctttttgacaactctcacattcctgga
tctccgtttggggctaacatacatcatccagttgacccatcgaaagttttggtaactaac
tctgctttgcaacacggaatagtgggtgaaccttgcattgtaaatatagactgtgcaaag
gtaggatctgaggatctatcagtgcaggccatctctgattcaggagttgtcgttgaaacc
gaagtgaaagagaacgaggatggcacatacactgttgtttatgtgccccgaactggaggt
gtatatacactgcttctcaaatatggaggaaaggtgctgcctgttcataaagtgatggtg
gaacagaaggtctacaaaagccatgtaaaagtgagcagaagaggaggcgttgtggttggc
gaaagagaaactgatgcaagccaagttgttgcaagtggtttgggtctccagaaaggcctc
atcggacatcctaacatgttttgtgtaaacaccagatctccagttgatgatcttggtgta
acagtggagggtccgtctgactgtcaggtgacgtgtaaagatggtggtcagggcgtgtat
ggtgtggaatatactccaacagtgcctggtgaatataagatatccataacctctggagag
aacagtattccaggaagcccatttgttgtgtcagtggatgatgtttcaaatactgcaggc
tctggagattgtctacaggctgggatttgcatatcttcaaatgctgttacttctcaagaa
atagtcaaacacaacggatccaggatgcacagagcgagtccagcttcattagtgaaagac
agaaagcccgtcttagatcctcaaagtctttatggaagcagcagtcccaaccagtttcaa
gcactacctaagtatggccgtgataaagagctttccttagctcatgatctgaacatggcc
gatattattgctcctggtattaaaggtggaatctgtggtaaaacccctcaaggcttcaca
attagctgcagcagcagtggagaatctccaaacgcagtggctgtggtgagacctgatgga
tctaaggagttcctggagctcacagacaacagagatggcagttgtagtggtgtctattta
cccaccatggacggttgtcattcattgatagtgaaattccccaatgaagagagttttaat
agacagttccaggtactgccgacagatgaattagccgaggttaatgtatcaggtccaggt
ctaacatcaggaatgtgtgctcagtgtcctcagacattcattatcgactgcacttcctca
agaaaaactctgcagtttgttaccatgatgacaccaaatggcataagtgagataatggag
gtcagagataatggtgactgcacatactctgtgaactacacacctacaatggaaggcctt
tattctttgatggtcaaatatactgatgatgattcattttgcagtcccttcaagtttcaa
gtgctccctgtgcccggtgttgattataaacatcctgaaactccagtttttgaatcaggc
ttcaaggcagatgtgtgtgtgaacactccacaggccttcattgttgatggcagtagcatt
ggagagccaccagagactgtagctctccttactcctgatggcaaaatcaaattattaagt
tcaaaagacaatggagatgggtcatatctagttgagtactccgcttctgctgaaggacct
cactcgatcatggccaaatataccaatgatgattgcttcagaagtattcacaggtttaat
gccattcctcctcacactgtcagaaaggataaagacattggaaataaaaaggaaaattcg
agtcaggagggaaatgtccactctaagcctccacatacattcactaacggctgccgtgtg
gaaccagaagctaatgctaaagctaatggctcaataaaactcgcagatatattggacaac
agggataaaaaatgtgagatgtcttgcacaccaaaaatgccaggctgtaagtctgtaatg
gacaaatacaacagcaaagaagctttcagaagcctccagacagatccgactgtaaataca
gagcaatcagtctgtgctcaaagtcctcagttgttcaggatcagctgtagtaaatccggg
aagccccctgactgtgtgctgatgatcagacctgatggagagactgaactgacagaggtc
aaagaaaaccctgacgggacttactctgtcaaatactgtcccactaatgaaggtcttcat
tccttaatggtcaaatatgttgatgatgattcattttacaatcctttgaggtttcatgtc
cttcctcacgctgatagtcatgacaaacatgtgattaatacaaatgaagcttgtagcaga
caattagaggaacgtgtcagcgctcaaattcctcagactttcacaacttgctgcaacact
aacgaggcctcagggacagagatgttgaaagctgatgatcatgttgaagtgttaaataat
gagaacacaaccagtgcaacaacacacacacctgaaccctcagcggtcagaaatgccaca
ctggaggattttcaaaggcaccagccaccatcctctcacacttcaagtgggtacaggggt
tttcaaaacaaggttgagggcaggaatgcaatccctcctgctgccattaatcaagcaggg
tttatatcctgtgatatagtcctgccaggagacttaagtgaaggtgaaattacaggagag
gtgatcacgccgtctggaaagagagcacagcctgacatgattgataataaagatgggact
gtcgttatgaagtttgatccttcagaggagggtcttcatcaaatccttattaaatcagca
gaaaatgatataccagaacttccactgcaatattatgcaaatagtcttgctaatcgcagc
cctgtggcctatgggcgtggccttgtgtgtggaattgcaaatgagactgcaacattcacc
atctgtcaggaggattcagcctcgagtgaactggacatcacaattgagggtccgtctgag
gctgatgtgcactgcttggacaatgaagatggcacttgttctgtgagttaccttccaact
gagcctggagattatgagatacaagttcaacataatgacgtgcctattccaggcagtcct
ttcaaggccaaaattacagatggacatatgagaaagtcagaggtcaaactgggcagtgcg
gtcgattttaccctggacatcaccgaagaagacattagccagctctccgctagcattatg
tcgcccacaggcaatgatgtaccctgcttactgaaaacacaagctgacagccatctcggc
atctccttcatccccagagaggctggtgagcatctggttagcatcatgaaggatggggag
catgtgagcaacagtcccatctctctgtccatcagtcaggcagagattggagatgccagt
aaggtgaaggccttcggtccaggcttacacaccgggcacaccttctgcaagtctgaattt
gtggtggacacttgggatgcaggatatggtggcttaacagttgtaattgaaggtcccagt
aaagtagacgtccacacaaaagagctggagaatgatggaacttgcaatatatcatactgc
ccaatcaagcctggcagctataaaatctccatcaaattctcagatgagcacattccaggg
agtccgtttacagctgtggtgaaagaccaagggcttatgagagagaacatcacatacaac
cagaaagctgctcctactgccagcattgggagtgaatgcagtttagccttcaaactccaa
gatgttgatcctgggactatgtctgctcatgtatatgaaccatcaggaagttttggagag
gctgttatccttcctagtacaggccgtgacatctatgtagtgagctttctagctaaagag
atgggagtttataatgtgagcatacagaacaaaggccagacgatttccggctgcccactt
caatacaccgtcggcccgctgggacgaggaggatctgagaaggtgcaggtttggggacaa
agccttcagacggctctggcaactgttccagctgactttaatatttggtcgcgtgaggct
ggagcaggggctctttctgtctccgtagagggtcctggagagattgagctcctctttgat
gagcagatggacgggtcttgcattgtgacctatactgcacaacagcctggtgactatgag
gtttcagtcatgtttgatgaggatcatgtttcccaaagcccttttcttgtgtctgtcatt
gccgccacagacactgctgtctctgatcaaactcagctgtgtaacggtcatggagaagcc
tctctgtcaggaccgcagatcaacacaacatctgacagcagtgctgagccagttttgctg
tctgacgctagtaaagtcatctgccacggcccaggcctgagtaagggctttctgggacgc
aaaaacactttttatgtggactgcagtaaagctggacgaaaccttctgttcgtgggcatg
catggccctacagttccctgtgagcgggtgtccatcattcacatgggccagtgtcagtac
aggatcaactacgctgtaaaggaaagaggaaaatatgtcttagcagtgaagtggggagat
gagcacattcctggatcgccgttttatattagtgttgtgtga

DBGET integrated database retrieval system