KEGG   Danio rerio (zebrafish): 563023Help
Entry
563023            CDS       T01004                                 

Definition
si:ch211-222g5.4
Orthology
K04437  
filamin
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563023
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    563023
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    563023
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   563023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 1538 aa AA seqDB search
MADFKCSVTSAAINLADDAPWKKIQKNTFTRWCNEHLRSVNMRISDLKTDLSDGLVLISL
LEVLSHKRMFRKYHTRPTFRQLKLDNVSVALEFLDHEKVKLVSIDSKAIVDGNLKLILGL
VWTLIQHYSISTPVWEDEANDSVSKLTPEMRLLGWIQNKVPELPITNFSQDWQDGKALGA
LVDGLAPGLCPDWESWDSVHRVSNTKEAMQQADDWLGVPQLIAPEEILDPAVDEQSVMTY
LSLFPKARLKPGAPLKPKKVPKPKACRATGRGLQSKGIRVEQLAEFKVDTCRAGPGNLDV
HIRDPSGSEVSVTQKELFKGVFGFQYTPSAEGDHTVDITWVGQHISKSPFKVNVGPEAGP
QKIRVWGPGLEGGTVGSPAQFMVESVGADSGMLGFAIEGPSQAKIACDDHNDGSCQVRFW
PTEAGEYAVHVMCDDEEIQDSPFMASIRPKSKGFHPDKVKVEGPGVSQTGCVINLQNEFI
VDTRQAGEGELAVFAQRADGECVDVTISSEQSGVFVCSYTPSSLSKHTIAVTWGGVMVPG
SPFIVTPRRIKITPCSPVWFKPDGSEICYSDEDFPENVHPGGRGELVMNVISPSNMPADA
TKVNAHGPGLTEGVVGEQAEFIIDTSRAGSGRLDVRVDGPSEVTLQCLDDQDGTCTVLYL
PTEHGMYQINVLFDNSHIPGSPFGANIHHPVDPSKVLVTNSALQHGIVGEPCIVNIDCAK
VGSEDLSVQAISDSGVVVETEVKENEDGTYTVVYVPRTGGVYTLLLKYGGKVLPVHKVMV
EQKVYKSHVKVSRRGGVVVGERETDASQVVASGLGLQKGLIGHPNMFCVNTRSPVDDLGV
TVEGPSDCQVTCKDGGQGVYGVEYTPTVPGEYKISITSGENSIPGSPFVVSVDDVSNTAG
SGDCLQAGICISSNAVTSQEIVKHNGSRMHRASPASLVKDRKPVLDPQSLYGSSSPNQFQ
ALPKYGRDKELSLAHDLNMADIIAPGIKGGICGKTPQGFTISCSSSGESPNAVAVVRPDG
SKEFLELTDNRDGSCSGVYLPTMDGCHSLIVKFPNEESFNRQFQVLPTDELAEVNVSGPG
LTSGMCAQCPQTFIIDCTSSRKTLQFVTMMTPNGISEIMEVRDNGDCTYSVNYTPTMEGL
YSLMVKYTDDDSFCSPFKFQVLPVPGVDYKHPETPVFESGFKADVCVNTPQAFIVDGSSI
GEPPETVALLTPDGKIKLLSSKDNGDGSYLVEYSASAEGPHSIMAKYTNDDCFRSIHRFN
AIPPHTVRKDKDIGNKKENSSQEGNVHSKPPHTFTNGCRVEPEANAKANGSIKLADILDN
RDKKCEMSCTPKMPGCKSVMDKYNSKEAFRSLQTDPTVNTEQSVCAQSPQLFRISCSKSG
KPPDCVLMIRPDGETELTEVKENPDGTYSVKYCPTNEGLHSLMVKYVDDDSFYNPLRFHV
LPHADSHDKHVINTNEACSRQLEERVSAQIPQTFTTCCNTNEASGTEMLKADDHVEVLNN
ENTTSATTHTPEPSAVRNATLEDFQRRGDHAVWKESTA
NT seq 4617 nt NT seq  +upstreamnt  +downstreamnt
atggctgactttaaatgtagcgttacttcagctgcaatcaacctggcagatgatgcacca
tggaagaagatccagaagaacacctttacacgctggtgcaatgaacacctgaggtctgtg
aacatgcggatcagcgatctgaagaccgatctgagcgatggccttgttctcatctctttg
ctggaggtcctgagccacaagaggatgtttagaaagtaccacacgagaccaaccttcagg
caactcaagctggacaatgtttcggtggctctggagtttttggatcatgaaaaggtcaag
ctggtgtctattgacagcaaagcaatagtggatggtaatttgaagctgatcctgggtctg
gtgtggaccctgatacagcattactccatctccaccccagtgtgggaggatgaggcaaac
gattctgtctccaaactgactccagagatgaggcttctgggatggatccaaaacaaagtt
cctgaactgccgatcaccaactttagccaggactggcaggatggcaaggccctcggggca
ttagtggatggacttgcacctggcttgtgtcctgactgggagagctgggactctgtgcat
cgtgtgagcaacactaaagaagcaatgcagcaagctgatgactggcttggggttcctcag
ctcatagccccagaggagattctcgatccagctgtggatgagcagtcggtgatgacatat
ctctcgcttttcccgaaagccagactgaaacctggagcaccgctcaagccaaagaaagtg
cctaaaccaaaagcctgtcgtgccacaggacggggattgcagtccaaaggcataagggta
gaacagctggctgaatttaaggtggacacatgtcgagctgggcctggaaatctggatgtc
catatcagagaccccagtggaagtgaagtgtcggtcacacaaaaggagctgttcaagggt
gtctttggcttccaatatacacccagtgctgaaggagatcacacagtggacattacatgg
gttggtcagcacatttccaagagcccttttaaagtcaatgttggtccagaagcaggacca
cagaagatccgagtgtggggaccgggactagagggaggaactgtgggctcaccggctcag
ttcatggtggaatctgttggtgctgattctggaatgctgggttttgccattgaaggtcca
tctcaggcaaagatcgcttgtgatgaccataatgacggatcctgtcaggtgcgtttctgg
ccgaccgaggcaggtgagtatgcagttcacgtcatgtgtgatgatgaagaaatccaggac
agtccattcatggcctccatcagacccaaaagcaaaggcttccaccctgacaaggtgaaa
gtagaaggaccaggtgtttcccaaactggctgcgtaataaacctccaaaatgaattcatc
gtggataccagacaggctggtgaaggagaacttgcagtttttgctcagagagcagatgga
gagtgtgtcgatgttacaatctcttctgaacaatctggtgtgtttgtctgctcctacacg
ccttcatctctctccaaacacaccattgctgtgacttggggaggcgtcatggttcctggc
agtcctttcattgtgacacctcgcaggattaagattacaccttgtagcccagtctggttt
aaaccagatggatcagaaatttgttactctgatgaagactttccagagaacgtccatcct
ggtggtcgaggagaactggtcatgaatgttatcagcccatcaaatatgccagccgatgcc
acaaaggtaaatgctcatggtcctggactgacagaaggtgttgttggagaacaagcagag
ttcattattgacacaagcagagcaggaagtggaagacttgatgtaagagtagacggaccc
agtgaggttacactacaatgtctggacgatcaagatggcacttgcactgtgctttacctc
cctacggagcatggaatgtaccaaatcaatgtgctttttgacaactctcacattcctgga
tctccgtttggggctaacatacatcatccagttgacccatcgaaagttttggtaactaac
tctgctttgcaacacggaatagtgggtgaaccttgcattgtaaatatagactgtgcaaag
gtaggatctgaggatctatcagtgcaggccatctctgattcaggagttgtcgttgaaacc
gaagtgaaagagaacgaggatggcacatacactgttgtttatgtgccccgaactggaggt
gtatatacactgcttctcaaatatggaggaaaggtgctgcctgttcataaagtgatggtg
gaacagaaggtctacaaaagccatgtaaaagtgagcagaagaggaggcgttgtggttggc
gaaagagaaactgatgcaagccaagttgttgcaagtggtttgggtctccagaaaggcctc
atcggacatcctaacatgttttgtgtaaacaccagatctccagttgatgatcttggtgta
acagtggagggtccgtctgactgtcaggtgacgtgtaaagatggtggtcagggcgtgtat
ggtgtggaatatactccaacagtgcctggtgaatataagatatccataacctctggagag
aacagtattccaggaagcccatttgttgtgtcagtggatgatgtttcaaatactgcaggc
tctggagattgtctacaggctgggatttgcatatcttcaaatgctgttacttctcaagaa
atagtcaaacacaacggatccaggatgcacagagcgagtccagcttcattagtgaaagac
agaaagcccgtcttagatcctcaaagtctttatggaagcagcagtcccaaccagtttcaa
gcactacctaagtatggccgtgataaagagctttccttagctcatgatctgaacatggcc
gatattattgctcctggtattaaaggtggaatctgtggtaaaacccctcaaggcttcaca
attagctgcagcagcagtggagaatctccaaacgcagtggctgtggtgagacctgatgga
tctaaggagttcctggagctcacagacaacagagatggcagttgtagtggtgtctattta
cccaccatggacggttgtcattcattgatagtgaaattccccaatgaagagagttttaat
agacagttccaggtactgccgacagatgaattagccgaggttaatgtatcaggtccaggt
ctaacatcaggaatgtgtgctcagtgtcctcagacattcattatcgactgcacttcctca
agaaaaactctgcagtttgttaccatgatgacaccaaatggcataagtgagataatggag
gtcagagataatggtgactgcacatactctgtgaactacacacctacaatggaaggcctt
tattctttgatggtcaaatatactgatgatgattcattttgcagtcccttcaagtttcaa
gtgctccctgtgcccggtgttgattataaacatcctgaaactccagtttttgaatcaggc
ttcaaggcagatgtgtgtgtgaacactccacaggccttcattgttgatggcagtagcatt
ggagagccaccagagactgtagctctccttactcctgatggcaaaatcaaattattaagt
tcaaaagacaatggagatgggtcatatctagttgagtactccgcttctgctgaaggacct
cactcgatcatggccaaatataccaatgatgattgcttcagaagtattcacaggtttaat
gccattcctcctcacactgtcagaaaggataaagacattggaaataaaaaggaaaattcg
agtcaggagggaaatgtccactctaagcctccacatacattcactaacggctgccgtgtg
gaaccagaagctaatgctaaagctaatggctcaataaaactcgcagatatattggacaac
agggataaaaaatgtgagatgtcttgcacaccaaaaatgccaggctgtaagtctgtaatg
gacaaatacaacagcaaagaagctttcagaagcctccagacagatccgactgtaaataca
gagcaatcagtctgtgctcaaagtcctcagttgttcaggatcagctgtagtaaatccggg
aagccccctgactgtgtgctgatgatcagacctgatggagagactgaactgacagaggtc
aaagaaaaccctgacgggacttactctgtcaaatactgtcccactaatgaaggtcttcat
tccttaatggtcaaatatgttgatgatgattcattttacaatcctttgaggtttcatgtc
cttcctcacgctgatagtcatgacaaacatgtgattaatacaaatgaagcttgtagcaga
caattagaggaacgtgtcagcgctcaaattcctcagactttcacaacttgctgcaacact
aacgaggcctcagggacagagatgttgaaagctgatgatcatgttgaagtgttaaataat
gagaacacaaccagtgcaacaacacacacacctgaaccctcagcggtcagaaatgccaca
ctggaggattttcaaaggagaggtgatcacgccgtctggaaagagagcacagcctga

DBGET integrated database retrieval system