KEGG   Danio rerio (zebrafish): 563180Help
Entry
563180            CDS       T01004                                 

Gene name
g6pca.2
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00052  Galactose metabolism
dre00500  Starch and sucrose metabolism
dre01100  Metabolic pathways
dre04068  FoxO signaling pathway
dre04910  Insulin signaling pathway
dre04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    563180 (g6pca.2)
   00052 Galactose metabolism
    563180 (g6pca.2)
   00500 Starch and sucrose metabolism
    563180 (g6pca.2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    563180 (g6pca.2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    563180 (g6pca.2)
   04920 Adipocytokine signaling pathway
    563180 (g6pca.2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     563180 (g6pca.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2 DUF373
Motif
Other DBs
NCBI-GeneID: 563180
NCBI-ProteinID: NP_001157278
ZFIN: ZDB-GENE-050309-17
Ensembl: ENSDARG00000013721
Vega: OTTDARG00000028402
UniProt: A2VD27 F1QHF8
Position
12
AA seq 355 aa AA seqDB search
MDAVMDTMHGFGVSSTQYLQTHYKDAQGWFLFVSFAADLRNTFFIFFPIWFHLKESVGIK
LIWVAVIGDWLNLVFKWILFGERPYWWVHETSYYMNSSAPHIEQYPMTCETGPGSPSGHA
MGAAGVYYTLVTSILAIMLSKGKKSTSNSLYLRGSLWTLFWTVQICVCLSRVFIAAHFPH
QVFAGVISGMIVAEAFNRQKWIYSASLKNYFNVTLFLLSFAVGLYVLLKALGVDLLWTLE
KAQKWCANPAWVHLDTTPFASLLRNMGTLFGLGLGLHSPLYTESKKSSNAFVRITCIIAS
LLLLHLFDSIKPPTHTAALFYLLSFCKSATVPLVTVSIIPYCLSGALGLQSKKQL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagtgatggatacaatgcacgggtttggtgtgagcagcacacagtaccttcag
actcattacaaagatgcccaaggatggtttcttttcgtctccttcgccgcagatctgagg
aacaccttcttcatcttctttcccatttggttccatctgaaagagtcagtgggcatcaag
cttatctgggtggcagtgataggagattggcttaatttagtcttcaaatggatccttttt
ggagaacgtccatactggtgggtccatgagacgtcctactacatgaacagctcagcgcct
catattgaacagtatcccatgacctgtgagactggcccaggtagcccatcaggtcatgct
atgggtgctgctggtgtttactacacactggtcacctccatcctcgccataatgcttagc
aaagggaagaaatcaacatccaatagcctatacttgcgtggctcactttggacactcttc
tggacggtccagatctgtgtttgtctctctcgggtcttcatcgccgctcatttcccacat
caagttttcgctggtgtcatttcaggcatgattgttgccgaggctttcaacaggcagaaa
tggatctacagtgcgagtctaaagaattacttcaacgtcacgctcttcctgctctcgttc
gctgtgggtttgtacgtcctcctgaaggctctcggtgtggatctgctctggactcttgag
aaagcccagaaatggtgcgccaacccagcctgggttcatttggacaccacaccgttcgca
agtctgctgaggaacatgggcaccctgttcggtctggggctcggtcttcattcaccgctg
tacacagagagcaagaaaagcagcaacgcttttgtcaggatcacctgtattatcgcatct
ctgctcctgctgcatctctttgactccatcaaaccaccaacgcacacggctgctctcttc
tacctcctgtccttctgcaaaagtgccaccgttcccctcgtcacggtcagcatcatcccg
tactgcttatccggagccctcgggttacagagcaaaaaacagctttag

DBGET integrated database retrieval system