KEGG   Danio rerio (zebrafish): 563180Help
Entry
563180            CDS       T01004                                 

Gene name
g6pca.2, im:6895556, im:7148077, si:ch211-215l11.5
Definition
glucose-6-phosphatase a, catalytic, tandem duplicate 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dre00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dre00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 355 aa AA seqDB search
MDAVMDTMHGFGVSSTQYLQTHYKDAQGWFLFVSFAADLRNTFFIFFPIWFHLKESVGIK
LIWVAVIGDWLNLVFKWILFGERPYWWVHETSYYMNSSAPHIEQYPMTCETGPGSPSGHA
MGAAGVYYTLVTSILAIMLSKGKKSTSNSLYLRGSLWTLFWTVQICVCLSRVFIAAHFPH
QVFAGVISGMIVAEAFNRQKWIYSASLKNYFNVTLFLLSFAVGLYVLLKALGVDLLWTLE
KAQKWCANPAWVHLDTTPFASLLRNMGTLFGLGLGLHSPLYTESKKSSNAFVRITCIIAS
LLLLHLFDSIKPPTHTAALFYLLSFCKSATVPLVTVSIIPYCLSGALGLQSKKQL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagtgatggatacaatgcacgggtttggtgtgagcagcacacagtaccttcag
actcattacaaagatgcccaaggatggtttcttttcgtctccttcgccgcagatctgagg
aacaccttcttcatcttctttcccatttggttccatctgaaagagtcagtgggcatcaag
cttatctgggtggcagtgataggagattggcttaatttagtcttcaaatggatccttttt
ggagaacgtccatactggtgggtccatgagacgtcctactacatgaacagctcagcgcct
catattgaacagtatcccatgacctgtgagactggcccaggtagcccatcaggtcatgct
atgggtgctgctggtgtttactacacactggtcacctccatcctcgccataatgcttagc
aaagggaagaaatcaacatccaatagcctatacttgcgtggctcactttggacactcttc
tggacggtccagatctgtgtttgtctctctcgggtcttcatcgccgctcatttcccacat
caagttttcgctggtgtcatttcaggcatgattgttgccgaggctttcaacaggcagaaa
tggatctacagtgcgagtctaaagaattacttcaacgtcacgctcttcctgctctcgttc
gctgtgggtttgtacgtcctcctgaaggctctcggtgtggatctgctctggactcttgag
aaagcccagaaatggtgcgccaacccagcctgggttcatttggacaccacaccgttcgca
agtctgctgaggaacatgggcaccctgttcggtctggggctcggtcttcattcaccgctg
tacacagagagcaagaaaagcagcaacgcttttgtcaggatcacctgtattatcgcatct
ctgctcctgctgcatctctttgactccatcaaaccaccaacgcacacggctgctctcttc
tacctcctgtccttctgcaaaagtgccaccgttcccctcgtcacggtcagcatcatcccg
tactgcttatccggagccctcgggttacagagcaaaaaacagctttag

DBGET integrated database retrieval system