KEGG   Danio rerio (zebrafish): 563180Help
Entry
563180            CDS       T01004                                 

Gene name
g6pca.2, im:6895556, im:7148077, si:ch211-215l11.5
Definition
glucose-6-phosphatase a, catalytic, tandem duplicate 2
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    563180 (g6pca.2)
   00052 Galactose metabolism
    563180 (g6pca.2)
   00500 Starch and sucrose metabolism
    563180 (g6pca.2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    563180 (g6pca.2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    563180 (g6pca.2)
   04920 Adipocytokine signaling pathway
    563180 (g6pca.2)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     563180 (g6pca.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 355 aa AA seqDB search
MDAVMDTMHGFGVSSTQYLQTHYKDAQGWFLFVSFAADLRNTFFIFFPIWFHLKESVGIK
LIWVAVIGDWLNLVFKWILFGERPYWWVHETSYYMNSSAPHIEQYPMTCETGPGSPSGHA
MGAAGVYYTLVTSILAIMLSKGKKSTSNSLYLRGSLWTLFWTVQICVCLSRVFIAAHFPH
QVFAGVISGMIVAEAFNRQKWIYSASLKNYFNVTLFLLSFAVGLYVLLKALGVDLLWTLE
KAQKWCANPAWVHLDTTPFASLLRNMGTLFGLGLGLHSPLYTESKKSSNAFVRITCIIAS
LLLLHLFDSIKPPTHTAALFYLLSFCKSATVPLVTVSIIPYCLSGALGLQSKKQL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatgcagtgatggatacaatgcacgggtttggtgtgagcagcacacagtaccttcag
actcattacaaagatgcccaaggatggtttcttttcgtctccttcgccgcagatctgagg
aacaccttcttcatcttctttcccatttggttccatctgaaagagtcagtgggcatcaag
cttatctgggtggcagtgataggagattggcttaatttagtcttcaaatggatccttttt
ggagaacgtccatactggtgggtccatgagacgtcctactacatgaacagctcagcgcct
catattgaacagtatcccatgacctgtgagactggcccaggtagcccatcaggtcatgct
atgggtgctgctggtgtttactacacactggtcacctccatcctcgccataatgcttagc
aaagggaagaaatcaacatccaatagcctatacttgcgtggctcactttggacactcttc
tggacggtccagatctgtgtttgtctctctcgggtcttcatcgccgctcatttcccacat
caagttttcgctggtgtcatttcaggcatgattgttgccgaggctttcaacaggcagaaa
tggatctacagtgcgagtctaaagaattacttcaacgtcacgctcttcctgctctcgttc
gctgtgggtttgtacgtcctcctgaaggctctcggtgtggatctgctctggactcttgag
aaagcccagaaatggtgcgccaacccagcctgggttcatttggacaccacaccgttcgca
agtctgctgaggaacatgggcaccctgttcggtctggggctcggtcttcattcaccgctg
tacacagagagcaagaaaagcagcaacgcttttgtcaggatcacctgtattatcgcatct
ctgctcctgctgcatctctttgactccatcaaaccaccaacgcacacggctgctctcttc
tacctcctgtccttctgcaaaagtgccaccgttcccctcgtcacggtcagcatcatcccg
tactgcttatccggagccctcgggttacagagcaaaaaacagctttag

DBGET integrated database retrieval system