KEGG   Danio rerio (zebrafish): 563288Help
Entry
563288            CDS       T01004                                 

Gene name
ncoa1, si:dkey-34f16.6, si:dkey-5g7.6
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     563288 (ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 1349 aa AA seqDB search
MLKMSAAGENALDPNILESRKRKGSPCDTSGPSVEKRRRELECRYIDELAELLSANMSDI
ASLNVKPDKCHILKSTVDQIQQIKRREQENAALMSPNDEVQQSDISSSSHGMVEKEALGP
LLLEALDGFFFVVNREGRIVFVSENVTGYLGYTQEELMTSSVYSILHVGDHNEFVRILLP
KSLVNGVPWSQEQGRRNSHTFNCRLLKRPPDEVDSENQEARQQYELMQCFTVSQPKALQE
EGEDLQSCLICIACQIPRPPQIPVSTESFITKQDPTGKIISIETSALRATGRPGWEDLVR
KCIYAFFQPQGNEPSHAKKLLHEVMTHGMAISPLYHFTLSDGTSLSAQTRCKFCCPQNPD
VQPFIMGFHTIDREHNTASSQENTTPSLSSPAAPPSRSPALQPSSDLSIHLNNTNGTCAT
PGPLTPTPPGYLTPSRVGPSQQVSSPSPLGSPLTATPTSFMSPRPPRGSPGLASSPRVPG
HPFSPSTPSIHSPAGGLTRQQSGGDGVGFSLPSPLPPRQTPTPSSSPARQPPAKPPEASN
DEPKSNQVGNPKLSQLLDGASAPEQDSQPRPSPTSQCPASHSSLTERHKILHRLLQDNSP
ADAGKEPDIKKEPPTSPNSALIARGLGKEPQDHQLLRFLLDTDEKDLEDLPPPATLSLQT
VKVKAEKKGSRENVSCAAALANNAMPGSPQSSGKASPQFPSTDLDTLNQLLPTLRASVGG
KTVEEPSEDSLSIGVNVKRESPGTSSQAFPDGENLSSQTSFDFCDPSTPNQGQSQVQVSD
LGQTELFQPPKESSSPFASPTSHNSFNTNTGLAKLELPDSQQFQALPLVEPMTFDNSLAN
QTQAPLSSPQEQCVPCPLDEMLCPPTTPEGRNDEKALLEQLVTFLSHTDESELAELDRAL
GIDKIVQSGCLEPVTQTPFPQSQPPTPVPLDPKLPSYPSQFPTSPSQFPAEMATAQGMSF
GAPRMPFPGNVVQAGMNRAPGVSNQLRLPPNQLRLQLQQRLQGPQQLQNRLAAMGSFPQG
GHVAMGMRQSIQQPQMPSQPPLNAQMMAQRQREVYSYQHRQRQLLQQKVMLMRQGINTGP
LGAQRLPKGPQQQQQPPPQQQQQFGFPPGYNAVPGNTPTSPSHFNPMGGPLDPKLSVRAG
LGNQGIMGAIQGQFGGPVNTPVQQGLFQQFGGSGMIQQADPSFAPELSPTSPLLSPQNST
SQSPLLQQTQPPPGYQSPDLKTWQQGTVANNGMYNQVGPPVSQSFGQQGVYNNMSITVSM
AGGSGAVNTLPPIGPSVGMGNNNLGNVTTMCNEQVQQVQVFADVQCTVNLVGSDSYLNQS
GPIGSQKGPSGTPSAQSQQKSLLQQLLTE
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatgagtgccgccggggagaatgcactcgaccccaacatcttagagtcacgg
aagaggaagggctctccatgtgatacctctggtcccagtgtggagaagcggcggcgggag
ctggagtgccgctacattgatgaactggctgagttactgtcggccaacatgagcgacatt
gccagcttgaacgtgaagccggacaaatgccacatcttaaaaagcaccgtggaccagatc
cagcagatcaaacggcgcgagcaggaaaatgcagctctgatgtctccaaatgatgaggtg
cagcagagtgacatatcgtccagcagtcatggcatggtggaaaaggaagctcttgggcct
cttctcttagaggccctggatggcttctttttcgtcgtgaaccgtgagggccgcattgtg
tttgtctctgagaacgtcaccggttatctgggttatacccaggaagagttgatgacctcc
agcgtctacagcatccttcatgtgggagatcacaacgagtttgtgcgcattctgctgccc
aagagccttgtaaatggtgtgccatggtctcaggagcaaggccggaggaacagccacacg
tttaactgcaggttgctgaaaaggcctccagacgaggtggactcagagaaccaggaggcc
cgacaacagtatgagctcatgcagtgcttcacagtctctcagcccaaagcgctgcaggaa
gagggcgaagacctgcagagctgtttgatctgtatagcatgtcaaataccccgtccacct
caaatccctgttagtacagagtccttcatcaccaagcaggaccctacagggaaaatcatc
tctattgagacgagtgctctgagggccacaggccgaccaggttgggaggatctggtcagg
aagtgcatctatgctttcttccagcctcagggcaatgagccctcccatgccaagaagctg
cttcatgaggtgatgacccacggcatggccatcagtcctctctaccatttcacactcagt
gacgggacgtccctcagtgcgcagacgcgctgcaaattctgctgcccccaaaacccagac
gtacagcccttcatcatgggctttcacactatagacagggaacacaacactgctagctct
caggaaaacactacccccagcctttcgtctcctgctgctcccccttcccgctcgcctgcc
ctgcaaccctccagtgacctcagcatccatctcaacaacaccaacggcacctgtgccact
cccggccccctcacgcccactccaccaggctacctgacgcccagccgcgtcgggccgtca
cagcaggtcagcagcccctctccactaggcagccctcttacagcaacccctacctcattc
atgtcgccccgacctccacggggcagcccgggcctggccagcagcccacgagtgcccgga
catccattctccccctcaacgcccagcatccactcgccagctggtggactaaccaggcag
caatctggcggcgatggtgttggtttctcgctcccttctcctttgccccccagacagact
ccaactcccagcagctcgccggcaaggcagcctcctgccaaaccgccagaagcatccaac
gatgagcctaaaagcaatcaagtcggcaaccccaagctcagccagcttttagatggcgca
agcgcccccgaacaagactcacaaccccgtccttcacccacgtcccaatgcccggcctcg
cacagcagcctgacagagcggcataagattctgcatcggctgcttcaggacaatagccct
gcagatgcgggcaaggagccggatattaagaaggagcccccgaccagtcccaactcagcc
ttgatagcacggggactcgggaaggagccccaggaccaccagctgctacgtttcctgctg
gatacggatgaaaaagacctggaggacttgccacctccggccaccctcagccttcagacg
gtaaaggtgaaagctgagaagaaaggaagcagagagaatgtgtcctgtgctgctgctttg
gccaacaatgccatgcctggctcacctcaatccagtggcaaggccagcccgcagtttccc
agtaccgatctggacactttaaaccagctcttgcccactctgagagcctctgttggaggt
aaaacagtagaggaacccagtgaggacagcctttccatcggggtcaatgtgaagagagag
tcacctggaacatcaagccaagcattccctgatggagaaaacctctcaagtcagacctct
tttgacttttgtgacccatccacaccaaaccagggtcagagtcaagtccaggtgtcggat
cttggccagacagagctgtttcagccacctaaggagagcagcagcccctttgccagtcca
acaagccacaactcttttaacactaacacaggtctggccaaactggagcttccagattct
cagcagttccaggctttgcctctggttgaaccaatgacctttgataacagtttggccaac
cagacacaggcccctctgtcctctcctcaagagcagtgtgtcccgtgtccgctggatgag
atgctgtgtcctcccaccaccccagagggacgaaacgacgagaaggccctgctggagcaa
ctggtcactttcttgagccacactgacgagagcgagctggcagagctggaccgagcgctg
ggcatcgataagattgttcaaagtggatgccttgaaccagtcacccagaccccctttcct
caatctcagcccccaacacctgtacccttggaccccaaactgcccagctacccctctcag
ttccccacctcgccctcacagtttcctgctgagatggccaccgcacagggcatgagcttt
ggggccccacggatgccgtttccaggcaacgtggtgcaggccggcatgaaccgagctccc
ggtgtgtccaaccagctccggctacctccaaaccagctgagactccagctccagcaacgc
ctgcaagggccacagcagctccagaacaggctggcagccatgggctccttcccccagggg
gggcatgttgccatggggatgcgtcagagcattcagcagcctcagatgccctctcagcct
ccgctgaatgctcaaatgatggcccagcggcagcgtgaggtctacagttaccagcaccgc
cagcggcagcttctgcagcaaaaggtcatgctaatgaggcagggaataaacacagggccc
ctgggggctcagagacttcctaagggcccccagcagcagcagcagccgccaccgcagcag
cagcagcaatttggctttcctccaggatacaacgctgtgcctggaaacacccctacctcc
ccgagccactttaaccccatgggaggacctctggacccaaagctgtccgtcagggcaggc
ctggggaaccaaggcattatgggagccattcaagggcagtttggggggcctgtgaacact
cctgttcaacaggggcttttccagcaatttggggggtctggcatgattcagcaagcagat
ccatcgtttgctcctgagctcagccccaccagccccctgctctcacctcagaactccacc
tcccagagtcctctgctccagcagacacagcctccgcctggttaccagtcacctgacctc
aagacctggcagcagggaactgtggcaaacaacggtatgtacaaccaggtgggtccgcca
gtctctcagagctttgggcagcagggcgtttataacaacatgagcatcaccgtgtcaatg
gccggaggctctggagcagtgaacactctacctcctattggtccatccgtcggcatgggc
aacaataaccttggcaacgtcaccacaatgtgtaatgagcaggtacagcaggttcaggtg
ttcgctgatgtccagtgcacggtaaacctagtgggcagtgactcctaccttaaccagtcg
gggcctatcggatcccaaaagggcccgagcggaacccccagtgcccagtcccagcagaaa
agcctcctccaacagctcctgaccgagtga

DBGET integrated database retrieval system