KEGG   Danio rerio (zebrafish): 563460Help
Entry
563460            CDS       T01004                                 

Gene name
nlk2, nlka
Definition
nemo-like kinase, type 2 (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563460 (nlk2)
   04310 Wnt signaling pathway
    563460 (nlk2)
   04068 FoxO signaling pathway
    563460 (nlk2)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    563460 (nlk2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     563460 (nlk2)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   563460 (nlk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 457 aa AA seqDB search
MALCGTTASNAAKMMAAYNGGTAAVAAHHPHHHHQLPHLPPPAHLHHHHHAGQHHHQHSH
HLQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLC
FFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILR
GLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPE
ILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACE
GARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEG
RLRYHTCMCKCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQK
GNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgcggaaccacggcttccaatgccgcgaaaatgatggctgcgtacaacggc
ggcaccgcggcagtggcagcgcatcacccgcaccatcaccaccagctgccacatctcccg
ccacccgcccacctccaccaccatcaccacgctggccagcatcaccaccaacactcgcat
cacttacaacaacagctggatatagagccggacagaccgatcggatacggagctttcggc
gtggtttggtcggtgacagaccccagagacggcaaacgcgtggccctcaaaaagatgccc
aatgtcttccaaaacctggtctcgtgcaagagggttttccgtgagctgaagatgctttgt
ttcttcaagcacgacaacgtgctgtcagctctggatattctgcagcctccacacatcgac
tactttgaggaaatttatgtggtgacggagctgatgcagagcgacctccataagatcatc
gtatccccacaacctctgagctcggaccacgtcaaagtctttctctaccagatccttcgt
ggattgaagtatctacactcagccggcattttgcacagagacattaaacctgggaacctg
ctggtcaacagcaattgtgtgctaaagatctgtgactttggcctggcgcgggtggaggag
ctggacgagtcacgtcacatgacccaggaggtggtgacgcagtactacagagcgccggag
atcctcatggggagcagacattactccaacgccatcgacatctggtctgtgggctgcatt
tttgctgagctgctcggccgacgcatccttttccaggcccagagtcccatccaacagctg
gacctgatcacagatctgctagggacgccatctctggaggccatgaggacggcctgtgag
ggggccagagctcacattctcagaggaccacacaaacagccctcacttccagtcctatat
accctgtccagtcaagcaacccatgaggccgttcacctcctctgcaggatgttggtcttc
gacccatcgaagcgaatctctgcgaaggatgccctggcacacccgtatctggatgagggg
cgtctgcgataccacacctgcatgtgcaaatgctgctacaccacgtcctccggccgcgtt
tacaccagtgacttcgaacccgtcacaaaccccaagtttgacgatggatttgagaagaac
ctgacgtcagttcggcaggtcaaagagatcattcatcagttcatcctggagcagcagaag
gggaatcgagtaccgctctgtatcaaccctcaatccgctgccttcaaaagctttatcagc
tcaacagtagctcagccctctgagatgcctccatctcctttagtttgggagtag

DBGET integrated database retrieval system