KEGG   Danio rerio (zebrafish): 563460Help
Entry
563460            CDS       T01004                                 

Gene name
nlk2, nlka
Definition
(RefSeq) nemo-like kinase, type 2 (EC:2.7.11.24)
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    563460 (nlk2)
   04310 Wnt signaling pathway
    563460 (nlk2)
   04068 FoxO signaling pathway
    563460 (nlk2)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    563460 (nlk2)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     563460 (nlk2)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   563460 (nlk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 452 aa AA seqDB search
MALCGTTASNAAKMMAAYNGGTAAVAAHHPHHHHQLPHLPPPAHLHHHHHHQHSHHLQQQ
LDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLCFFKHD
NVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILRGLKYL
HSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEILMGS
RHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGARAH
ILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYH
TCMCKCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQKGNRVP
LCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgcggaaccacggcttccaatgccgcgaaaatgatggctgcgtacaacggc
ggcaccgcggcagtggcagcgcatcacccgcaccatcaccaccagctgccacatctcccg
ccacccgcccacctccaccaccatcaccaccaccaacactcgcatcacttacaacaacag
ctggatatagagccggacagaccgatcggatacggagctttcggcgtggtttggtcggtg
acagaccccagagacggcaaacgcgtggcactcaaaaagatgcccaatgtcttccaaaac
ctggtctcgtgcaagagggttttccgtgagctgaagatgctttgtttcttcaagcacgac
aacgtgctgtcagctctggatattctgcagcctccacacatcgactactttgaggaaatt
tatgtggtgacggagctgatgcagagcgacctccataagatcattgtatctccacaacct
ctgagctcggaccacgtcaaagtctttctctaccagatccttcgtggattgaagtatcta
cactcagccggcattttgcacagagacattaaacctgggaacctgctggtcaacagcaat
tgtgtgctaaagatctgtgactttggcctggcgcgggtggaggagctggacgagtcacgt
cacatgacccaggaggtggtgacgcagtactacagagcgccggagatcctcatggggagc
agacattactccaacgccatcgacatctggtctgtgggctgcatttttgctgagctgctc
ggccgacgcatccttttccaggcccagagtcccatccaacagctggacctgatcacagat
ctgctagggacgccatctctggaggccatgaggacggcctgtgagggggccagagctcac
attctcagaggaccacacaaacagccctcacttccagtcctatataccctgtccagtcaa
gcaacccatgaggccgttcacctcctctgcaggatgttggtcttcgacccatcgaagcga
atctctgcgaaggatgccctggcacacccgtatctggatgaggggcgtctgcgataccac
acctgcatgtgcaaatgctgctacaccacgtcctccggccgcgtttacaccagtgacttc
gaacccgtcacaaaccccaagtttgacgatggatttgagaagaacctgacgtcagttcgg
caggtcaaagagatcattcatcagttcatcctggagcagcagaaagggaatcgagtaccg
ctctgtatcaaccctcaatccgctgccttcaaaagctttatcagctcaacagtagctcag
ccctctgagatgcctccatctcctttagtttgggagtag

DBGET integrated database retrieval system