KEGG   Danio rerio (zebrafish): 563460Help
Entry
563460            CDS       T01004                                 

Gene name
nlk2, nlka
Definition
nemo like kinase, type 2 (EC:2.7.11.24)
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dre04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 457 aa AA seqDB search
MALCGTTASNAAKMMAAYNGGTAAVAAHHPHHHHQLPHLPPPAHLHHHHHAGQHHHQHSH
HLQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLC
FFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQILR
GLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPE
ILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACE
GARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEG
RLRYHTCMCKCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQK
GNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgcggaaccacggcttccaatgccgcgaaaatgatggctgcgtacaacggc
ggcaccgcggcagtggcagcgcatcacccgcaccatcaccaccagctgccacatctcccg
ccacccgcccacctccaccaccatcaccacgctggccagcatcaccaccaacactcgcat
cacttacaacaacagctggatatagagccggacagaccgatcggatacggagctttcggc
gtggtttggtcggtgacagaccccagagacggcaaacgcgtggccctcaaaaagatgccc
aatgtcttccaaaacctggtctcgtgcaagagggttttccgtgagctgaagatgctttgt
ttcttcaagcacgacaacgtgctgtcagctctggatattctgcagcctccacacatcgac
tactttgaggaaatttatgtggtgacggagctgatgcagagcgacctccataagatcatc
gtatccccacaacctctgagctcggaccacgtcaaagtctttctctaccagatccttcgt
ggattgaagtatctacactcagccggcattttgcacagagacattaaacctgggaacctg
ctggtcaacagcaattgtgtgctaaagatctgtgactttggcctggcgcgggtggaggag
ctggacgagtcacgtcacatgacccaggaggtggtgacgcagtactacagagcgccggag
atcctcatggggagcagacattactccaacgccatcgacatctggtctgtgggctgcatt
tttgctgagctgctcggccgacgcatccttttccaggcccagagtcccatccaacagctg
gacctgatcacagatctgctagggacgccatctctggaggccatgaggacggcctgtgag
ggggccagagctcacattctcagaggaccacacaaacagccctcacttccagtcctatat
accctgtccagtcaagcaacccatgaggccgttcacctcctctgcaggatgttggtcttc
gacccatcgaagcgaatctctgcgaaggatgccctggcacacccgtatctggatgagggg
cgtctgcgataccacacctgcatgtgcaaatgctgctacaccacgtcctccggccgcgtt
tacaccagtgacttcgaacccgtcacaaaccccaagtttgacgatggatttgagaagaac
ctgacgtcagttcggcaggtcaaagagatcattcatcagttcatcctggagcagcagaag
gggaatcgagtaccgctctgtatcaaccctcaatccgctgccttcaaaagctttatcagc
tcaacagtagctcagccctctgagatgcctccatctcctttagtttgggagtag

DBGET integrated database retrieval system