KEGG   Danio rerio (zebrafish): 563490Help
Entry
563490            CDS       T01004                                 

Gene name
si:dkey-23a13.8
Definition
(RefSeq) histone H2B 1/2-like
  KO
K11252  
histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    563490 (si:dkey-23a13.8)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   563490 (si:dkey-23a13.8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 161 aa AA seqDB search
MHQSEGWLFLLKSAQGPNKFLCLTRIVDRTYYLLHSNMPEPAKPAPKKGSKKAVTKTAGK
GGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYN
KRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaatcagaaggctggttattccttctgaaatctgcacaagggcctaataaattc
ttatgtctcacccgtatagttgacagaacatattaccttctccattcgaatatgccagaa
ccagcgaagcccgcacccaagaaaggctccaagaaggcggttactaaaaccgctggtaaa
ggaggaaagaagcgcaagaggaccaggaaggagagctatgctatctacgtgtacaaagtg
ctgaagcaggttcatcctgacactggtatctcctctaaagcgatgggcattatgaattcg
ttcgtcaacgacatcttcgagcgcatcgccggtgaggcttctcgtctcgctcactacaac
aagcgctccaccatcacatcaagagagatccagaccgccgtgcgtctgctgctgcccgga
gagctggccaaacacgccgtgtctgagggcacaaaggccgtcaccaagtacaccagctcc
aagtaa

DBGET integrated database retrieval system