KEGG   Danio rerio (zebrafish): 563546Help
Entry
563546            CDS       T01004                                 

Definition
ubiquitin carboxyl-terminal hydrolase 21-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 405 aa AA seqDB search
MPRAESTSMDNSCQALYRTLVTQNGLQPENVDISQSVLYTSIMGLLLVTDKERELQLGNG
QVGLRNVGNTCFLNAIVQCLSHTRSLRDYCLMRAYVQDKHSNQEPVLMDEFSKVLAGLWE
CDAGETTVNPGKFYRVFKESVPYFSGYSQQDAQEFLRFLLDRLHTEINRRPSKRPAVIER
KEPAYTRFRISEEAFAMWQRHLDRDDSKIVDLFSGQLRSSLHCSVCSHYSNTFDVFCDLS
LPIPKQKSDYGRAVTLRECLDLFSQEEKLDKENSPMCERCNRRTESTKRLTIQRFPRVLV
IHLNRFAMSRFSISKSTVPVSFPLTALDLGLFGPVDCGPVLYDLYAVCNHSGTVNMGHYT
AACREEEGWCFYNDSCVDAISEEKLQSNQAYVLFYELKSCNISRK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccaagagctgaatccacctcaatggacaactcgtgtcaggccctgtaccgcacccta
gtcactcaaaatggccttcagccagaaaacgttgacatttcccaatctgtactgtacacg
tccatcatgggactgctgctggtgacggataaagagagagagctgcagctggggaacgga
caagttggattgaggaatgtgggaaatacttgtttccttaatgccattgtgcagtgtctg
tctcacactcgtagtcttcgggattattgtctgatgagagcctacgttcaagacaaacac
tccaaccaggagcctgtgcttatggatgaattctcaaaagttttggctggcctatgggaa
tgtgatgctggagaaaccacagtgaatcctgggaaattttatcgtgtctttaaagagtct
gtgccttacttcagtggctatagtcagcaagatgctcaggagttcttgcggttccttctg
gacaggctccatacagaaataaaccgtcgtccatccaaacgtccggcagtcatcgaaagg
aaggaaccggcatacacacgattcaggatttcagaagaggcctttgcgatgtggcagagg
catctggacagggatgacagtaaaattgttgatttgttctctggtcagctgcgaagttcc
ctgcactgttcagtctgttcccattactccaacacatttgatgtgttttgtgacctgtca
ctccccatcccaaagcagaaaagtgattacggccgagctgtcacactgagagaatgtcta
gacctcttttcacaagaggaaaaactcgataaagaaaactcaccgatgtgtgagcggtgt
aaccgtcgcaccgaaagcacaaaacgactgaccatccaaagattccccagagtcctggta
atacacttgaatcgattcgccatgtctaggttctcaatctctaaaagcacagtgccggtc
tctttccccctgacggctttggatttggggctgtttggacctgttgactgtggtccagtg
ctgtacgatctgtatgcagtgtgcaatcattcaggcactgtaaatatgggtcactacacg
gctgcatgtcgagaggaggagggctggtgcttctataatgactcatgtgttgatgcaatt
tcagaggagaagcttcagtccaatcaggcgtatgtgctcttctatgagctcaagagctgc
aatatttcccgaaaatga

DBGET integrated database retrieval system