KEGG   Danio rerio (zebrafish): 563589Help
Entry
563589            CDS       T01004                                 

Gene name
chkb, fc21g05, si:ch211-218c17.2, wu:fc21g05
Definition
choline kinase beta
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    563589 (chkb)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     563589 (chkb)
    2.7.1.82  ethanolamine kinase
     563589 (chkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
18
AA seq 451 aa AA seqDB search
MLLLGRVGALRYSGSVLSLSLIHIGFLARKIMNSGQTVKCLSDTAGNVGIRVKDDADSDR
LVGGDSLMVAEERHPRSASPRGTNGDDDSEAESHQDGRNVDVDPDTRRRAFSWCRDFLSG
SWKVITEHDFQIKIVSGGLSNLLYMCSLPDDVKPAGVEPRRVLLRIYGAILQGVDSLVLE
SVMFAILAERELGPRLYGIFPEGRLEQYLPSNRLRTEQLSYSQISAEIASKMARFHGMEM
PFNKEPKWLFGTIDRYMDQVKTLKFVREAHIKKFNKLMKYDLPAELESLRSLLAATPSPV
VFCHNDVQEGNILMLDGRENSADKLMLIDFEYSSYNYRGFDFGNHFCEWIYDYTYDQWPF
YKAKVENYPNREQQLHFIRHYLSEKGGVSPADQARIEEDMIIEANRFALASHFLWGLWSI
IQAKLSKIEFGYMDYAQHRFDTYFKQKKLIS
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttctggggcgtgtcggagcacttcgttatagcggttccgttctctcactttct
ttaatacacattggatttctagcgcgtaagattatgaattctggccagacagtgaagtgc
ttgagtgatacagctggaaatgtgggcatacgcgtaaaggatgacgcggattcggacaga
ctcgttggtggagactcgctgatggtggcggaagaaagacacccgagatcggccagtccc
agaggcacaaacggggatgatgactccgaagcggagtcccaccaggacgggcgtaacgtg
gatgtggacccggataccaggaggagggcgttcagctggtgccgtgactttctgtccggg
tcatggaaagttataacggagcatgacttccagattaaaatagtcagtggaggactcagt
aacctgctgtacatgtgcagtttaccagatgatgttaagccggccggggttgaacctcga
agagttctgctccgtatctatggggccattttacagggcgtggattcacttgttttggaa
agtgtgatgtttgccattttagcagagagagagttgggcccgcgtctctatggcattttc
ccagagggtcgtctggagcagtatttgcccagcaatcgtttgcgtacagagcagctgtca
tactctcagatctcagccgaaatagccagtaagatggcacgattccatggcatggagatg
ccatttaacaaggagcccaaatggctgtttggaaccattgacaggtatatggatcaagtt
aagacattgaaatttgtgcgtgaagctcacatcaagaaattcaacaagctgatgaagtat
gatcttcctgcagaactggaaagtctgaggtcactgctggcagctaccccctctcctgtg
gtgttctgccataatgacgttcaggaagggaacattctcatgttggacggccgggagaat
tcagctgacaagctaatgcttatcgattttgaatacagcagctataattacagaggcttt
gattttgggaatcatttttgtgaatggatttatgactacacatatgaccagtggcctttc
tataaggcaaaggtggaaaattatcctaacagagaacagcagttacattttatcagacac
tatctgtcagaaaaagggggtgtttcaccagcagaccaggccaggatagaagaggacatg
atcatcgaagctaaccggtttgcccttgcgtctcatttcctctggggtttatggtccatt
attcaagctaagctctccaaaatcgagtttggatacatggattatgcacagcacaggttc
gacacctatttcaaacagaagaagctcatttcctaa

DBGET integrated database retrieval system