KEGG   Danio rerio (zebrafish): 563799Help
Entry
563799            CDS       T01004                                 

Gene name
ash1l, fi34d11, si:ch211-81a5.3, wu:fi34d11
Definition
ash1 (absent, small, or homeotic)-like (Drosophila)
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    563799 (ash1l)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    563799 (ash1l)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     563799 (ash1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 2988 aa AA seqDB search
MDQRTQGGPSTPPPLPANAPPAEREKEGVGGKKDDEEEKKKREKLRDGAQNEASGAESGT
GDQPQQPTQFSVKETSYSEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHSGGRG
GGRANRGAGASDANSNSTSTSNGKEGEKKPSVNRGASQSAAAPAASTPSPSLPPASINTV
TPVNGNAPAKRGPPKLACKSEGKADVKSVASSEKPLNLHRPTTESKSHSSGKKNHVPQTN
SAPAPSPPAVPPAATSQQDPKIDGILKTPQCNFLEGQKEQERGISSWGTPTVTEKLAQLI
ATCPPSKCPKPKARKVSPAPAHSSSPPLISNLQRPERAMANRNTYSRAVHLAQPPPVSRP
PGRPYGSKNKDSILEKFSGTSKKEESDGLSKGVSGSSSTTTTTTSSALSQNSSRLTTTTS
TNESTDINNTDGMKSQSRLGHCPSHSSSAAASPPFSSSSSVERIGSTSCNIGLPGSLTSR
PKASPSRIEDFSEKDKERDREKDTDSPRDLSKGITPAITGKQDAKERCSLSAPRNDRGKS
SSPVKRSPNQESRVSGVPSPAESTKCTISPSYPSGASRSPPPLCDDTGAISPASPSEQDS
KPLKKRRGRRPRWTKAVSRTHKSLHESPSNHQQIPTPMPSGLSFSSPIRESVEQPLSDSY
TSPEDSDIFDSSPKKRGRPKTKMPRLDAPAHGCTPNKLAPSKSFSSLLKSKEEQDPPVLH
PEVDFNPPKMMARKRGRPKRSPPTLPQETQPPTLAPESGEASVGEKPFRNKGNGQLIMKT
IIGKINKMKTVKRKRLLSQILLGPKPAEEQECSRSSGPTGSPVATKPQSLTSLAATFGGK
LGPQINVSKKGTIYMGKRRGRKPKTSTNPSPGAPTPPPEPFLSPNTSSPHHHQVQALQNQ
PHQLPPSEVFPSPSLSQSSGGQSPISDASFVEPGSVHFSSHPHCSHSHQVHHSFSFPPPT
FSAPSARSVASAATSTAHPSQKKSSCRGYHHHHHHYRQHYHYRKFSPPRPLLPTSPAPLS
ELKEATPSPVSESHSEETVPSDSGIGTDNNSTSDRGEKAGSANGLPGVGVSQGMAGGLLM
PGVIGPGIGTGIGLSSRGRRRHSSSVLLERPSPTPSPLGVRASPDPRRSHPAAPSSALVG
HKEKHKHKCKRRGHGCPSYDKLKRQKRKRKKKYLQLRSRRQDPDFLADLDEICVQLSDIR
ISHRTPTLRLGSSIGLGAGAGPGRGSGLGSTRPSSSLGGGTNPPPHHYLHRDLLPTIFRI
NFSGYYSPHPAYPCDSLHYVRKPDLKKKRGRPPKLRESISEVPFVPGLGFPLSSGGFYHP
SYGVPYSSTPLGLGYYRGYTPPSALYPHPHHQAPHSGPSHHVHSPSFPPPPPPSYVHHHH
PSHLLLNPSKFHKKKHKLLRQEYLGGGRSSMLYPAMSSELSFGWHHKHKHRHKHRDRCGE
EEGDDGGGVLGGIGGRGVGGEGLGAGRGERGSVESLQHCRFGRDGSADSRTNKQSASANS
PSSSSTSSAERYKRKEASMSCLGPSRLSLGTASRGHHPVDSWFRMGSSDTDYSKLSRNQS
FSGSGAFSEGHVQNPVDCSESDEEDAASPIEEPEISHHTNLFASALSRTSLKGSRSKKGG
PLESPSLSRLDRTVRRDRSTSSEKREIGNVSSLQNRVGQSSVPDVSEGLHHRHHHHHHPP
LSLSHAASCLPHCTLDQPGNTAPLRPSSRQASPSTCSSQPACCLDSPPSHLSHRPPPKNN
LLHVNKILRAKKLQRQARTGNNMVKKRGPGRPRKNPLPSPPATPPPQTSEQDNHPLPERH
RATALWEADTVVDAIEAVVQNQRKKGRKRKHWERETEGGDEEEEDAEEERQVEDEEEEED
EEQEQQSAAREDDVMSRVRTEGSRQWLTQEEVHCFRSALEGKPDGSPERPGPATSEPTPN
PSVTSQREKRVARPPKKKFQKAGLYSDVYKTDDPRSQLLQLKKEKLEYTPGEHDYGLLPA
PIHVGKYLRQKRIDFQLPYDILWLWKHDQLYKRPDVPLYKKIRSNVYVDVKPLSGYEATT
CNCRLPDDSSEKGCQDDCLNRMIYAECSPSTCPCSDQCDNQRIQKHEWVQCLERFRAEGK
GWGIRTKQPLRAGQFIIEYLGEVVSEQEFRKYIASDCRLHQVKIPMLGENKKQIGVSRMM
EQYFSHSGHYCLNLDSGMVIDSYRMGNEARFVNHSCEPNCEMQKWSVNGVYRIGLFALKD
INSGTELTYDYNFHSFNTEEQQVCKCGSEGCRGIIGGKSKRINGLPAKGAGSGGGARRLG
RLKEKRKSKHSLKKREEESSDSSKFYQHLLMKPMSNRERNFVLKHRVFLLRNWEKMREKQ
ELLKREGERERENSGLSLYTRWGGVIRDDGNIKSDVFLTQFSALQTSRSVRTRRLAAAEE
NTEVTRTARLAHIFKEICDMITSYKDSSGQPLAAPLLNLPSRKRNTQYYEKVTDPLDLST
IDKQILSGHYKTDEAFDADMLKVFRNAEKYYGRKSAVGRDVCRLRKAYYGARHEAAVQID
EIVGETASEADSSDSLERDHAHHHHHDGGGSHDKDDDVIRCICGMYKDEGLMIQCEKCMV
WQHCDCMRLEADVEHYLCEQCDPRPVDREVPMVPQPSYAQSGFIYYICLLRDDLLLHQGD
CVYLMRDSRRTTEGQPVRQSYRLLSHINRDKLDIFRIEKLWKNEKGERFAFGHHYFRPHE
THHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLYTYCKGRPKGVKEQDVYICDYRL
DKSAHLFYKIHRNRYPVCTKPYAFNHFPKRLTPKRDFSPHYVPDNYKRNGGRSAWKSERP
KDEEPSSSSTSCERLSSSFPREGDEDGGRGAEGDAEAAQEGSSTPRPQRSSPLESRTAGE
EDEAEEEEDRERRREMQEEEEEEGCREKAGAQEPIDAQCSSSISSSPLHPAILGRREAQR
ERLNKILLDLLHRAPTKNAIDVTYLLEEGSGRRLRRRTLGLSEFICRK
NT seq 8967 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaggacacagggggggccttctacgccgcccccactccctgccaatgccccc
ccagcagaacgtgaaaaagaaggtgtaggaggaaagaaggacgatgaagaagagaaaaag
aaacgggagaaactaagagatggggcacagaatgaagctagtggtgctgaaagtgggact
ggtgaccagccgcaacaacccacgcagttttcggtcaaggagaccagctactctgagggt
aacgttaagctcaaaataggcctgcaggccaaacgcatgaagaaacctcctaagatcctg
gagaactatgtctgccgaccagccttccgtgccactgtaaggcatagtggaggtagaggc
ggaggacgtgctaatcgtggggctggagccagtgatgcgaacagcaactctactagcaca
agtaatggaaaggaaggggagaaaaagccctctgtcaaccgaggagcatctcagtcagct
gctgctcctgctgcttctactccctcaccctctcttcctcctgcttccatcaacactgtc
actccagtgaatggaaatgctccagcaaaaaggggtcctccaaaacttgcctgcaaatca
gagggaaaggctgacgtaaaatctgttgcttcatcagagaaacctcttaatctccatcgc
cccacgacagaaagtaaatcacactcctctggaaagaaaaaccatgttccacaaacaaac
tctgcccctgccccatctccaccagcagtgcccccagctgccacttcgcaacaggaccct
aaaatagatggaatcttaaaaacgcctcaatgcaattttttggaggggcagaaggaacaa
gaaagagggatttcttcttggggtacccctacagtaactgaaaaacttgctcagctcata
gctacatgcccaccttcaaagtgccctaagccaaaagcccgaaaggtatcgccagctcca
gcacacagtagctcacctccgttaatttctaatctgcagcgccctgaacgggcaatggct
aatagaaacacctattccagggcggttcacctcgcccaaccaccacctgtatcacggccc
cctggtcgcccatatgggtctaaaaacaaagacagtatccttgagaaattttctggaact
tctaaaaaagaggaatcagatggactttcaaaaggggtctccggtagcagcagcacaacc
accaccaccactagttcagcactgtctcaaaacagcagtcgcttgacgacaacaacatcc
acaaatgaaagcactgacattaacaacacagatggaatgaaatctcagtctcgtcttggg
cattgcccatctcattcttcatccgcagctgcttcacctccattttcttcttcatcctcc
gtagagagaataggaagtacaagctgtaacataggtttgccaggctctctaacctcacgc
cctaaagcaagcccctctcgaatagaggattttagtgagaaagacaaagaacgtgaccgg
gaaaaggacacagacagtccaagagatttaagtaaaggtatcactccagctataactggg
aagcaggatgcaaaagaaaggtgttctttatcagctcctcgaaatgacaggggtaagagc
tcaagcccagtcaaacgtagtcccaatcaggaaagtcgcgttagtggggtaccaagtcct
gctgagtccaccaaatgcactatttctccttcatacccttctggtgccagcaggagccca
ccaccactatgcgatgacaccggggctatttctcctgcatcaccatctgagcaggattca
aaacctcttaagaagcgacgaggacgacgacctcgctggacgaaggcagtgagtcgcacc
cacaagtctttacatgagtctccttctaaccatcagcaaatccccacaccaatgccctca
gggctttctttctcatcccctattcgggagtctgtggagcagcctctcagtgacagttac
acatccccagaggattctgatattttcgattcttcgcccaagaagagaggacgtccaaag
accaaaatgcctcgattagatgcaccagcacatggctgcaccccaaacaagttggcacct
tcaaaatccttctccagtctgctcaagtctaaggaagagcaggacccccctgttttgcac
cctgaagtggattttaatccacctaaaatgatggcaagaaagcgagggcgacccaagcgc
tcacctccaactcttcctcaagaaacccagcctccgactcttgctcctgagtcaggggaa
gcatcagttggggaaaaaccttttcgtaataagggtaatgggcagctcattatgaagacg
atcataggcaaaatcaataaaatgaagacagtaaaacggaagaggctcctcagccaaata
ctgcttgggccaaaaccagcagaggagcaggaatgctcaagaagcagtgggccaacaggg
tctccggttgctacaaaaccacagtccctgacatcacttgctgctacatttggtggcaaa
ttagggccccagattaatgtaagcaaaaaggggacaatatatatgggtaaaagaaggggt
cgtaagccaaaaacatcaactaatccttccccaggtgcccccacaccccctcctgagcct
ttcttatcaccaaacacttcatcccctcatcatcaccaggtgcaggctttacaaaaccaa
ccacaccagttgcctccatctgaggtgtttccttccccatcactatcacagtcaagtggg
ggccaaagccccattagtgatgctagctttgtagagcctggctcagtgcatttctcatct
cacccacactgcagtcattctcatcaggtccaccactcattctcatttccaccgcctact
ttttcagccccctctgctcgatctgtagcaagtgctgcaacatccactgcacacccatct
cagaagaagtcctcttgccggggttaccatcatcaccaccaccattaccggcagcactat
cattatcgaaaattttctcctccaaggccactattgccaacgtctccagctccactgagt
gagctgaaagaagccacaccttctccagtgagtgaatcacacagtgaagagactgtaccc
agtgacagtggcattggaacagacaataatagcacctctgaccgtggggaaaaagctgga
agtgccaatggcttacctggtgtgggggtctcacagggtatggcaggtggactcttaatg
cctggagtcataggtccaggtattggaacgggaattggactttcttcgagaggtcggagg
aggcactcatcttcagttcttctagaacgtccctcacctacaccctcacctcttggagtg
agagcatcacctgacccaagaagatcgcaccctgctgccccatcttctgctttggttgga
cataaagagaaacacaagcataagtgcaagcgtcgtgggcatggctgccctagctatgac
aaactaaaaaggcaaaagcgtaaacgcaagaagaagtacctgcagctacggtcccgcaga
caagacccagattttttggctgatttagatgagatatgtgtgcagcttagtgatatacga
atttctcatcgaacacctacacttcgtttgggcagcagcataggtttgggtgccggggct
ggtcctggccgtgggtctggcttgggaagtaccagacctagcagcagccttggaggcgga
accaatccaccaccccatcactatctgcatagagatctattacccacaatattcaggata
aattttagtgggtattattcaccccacccagcctacccatgtgattcacttcattacgtt
cgtaagccagatcttaaaaagaaaagaggtcgaccacctaagcttcgggaatccatatca
gaagtaccttttgtacctggtttaggctttcccctctcaagtggaggtttctatcaccct
tcttatggtgtcccatactcttctaccccactgggacttggttactatcgtggttatacc
ccaccaagtgccctgtacccccatcctcatcaccaggctccccactctggcccatcccac
catgttcattcaccatcttttcctccacctccacccccttcttatgtgcatcatcatcac
ccatcccacctgcttcttaacccctccaaatttcacaagaagaaacataagctacttagg
caagagtatttaggtggtggtcgttcatccatgctctatcctgccatgtcatctgagctg
tcatttggctggcaccacaaacacaagcataggcacaaacaccgtgatcgctgtggagaa
gaggagggtgatgatggtggtggagttttaggtggtataggaggcagaggtgttggaggt
gagggcttgggggccggaagaggggagagagggagcgtagagtccctgcagcactgccgg
tttggacgagatggctctgctgactcccgaactaacaaacagtcagcttctgccaactcc
ccttcctcttcctccacatcctctgcagaacggtacaagcgaaaagaggcctctatgtct
tgtcttgggccctcacgactgtctttgggcactgcaagtcggggacatcatcctgttgac
tcctggttcagaatgggaagttctgatactgattactccaagctctctagaaaccagtct
ttttcggggtctggtgcattctctgaaggacatgtgcaaaatccagtggattgctcagag
agtgatgaggaagatgctgcttcccccattgaagagccagagatcagccatcacacaaac
ctgtttgcatctgcactatcaaggacctccctcaaaggaagtcgcagcaaaaaaggtgga
ccattagagagtcccagtctctcacggttggacaggacggttagaagggatcgttcaaca
tcttcagagaaaagagaaattgggaatgtatctagcttgcagaacagagttggccaatcc
agtgttcctgatgtttctgagggtctccatcatcggcaccaccatcaccaccaccctcct
ctatccctctcgcacgctgcctcttgcctgccgcactgcactctagaccagcctggaaac
actgcaccactccggccctccagccgccaagctagtccatccacatgctcctcccagcct
gcatgctgccttgattccccaccttcacatctctcccaccggccccctcccaaaaacaac
ctgcttcatgtcaacaagatcctccgtgcaaagaagctccaaaggcaagcacgtacaggg
aacaacatggtgaaaaaacggggtccaggacgtccccgcaagaacccgctgccctcacct
cctgcaacacccccaccacagacttccgaacaagacaaccacccattacctgaaaggcac
cgagcaactgcactctgggaggcagatactgtagttgatgccattgaggctgtcgtacag
aaccagcgcaaaaagggacgcaagcggaagcactgggaaagggagactgaaggaggtgat
gaagaagaggaggatgcggaggaagaaagacaggtggaggacgaagaagaagaagaagac
gaagaacaagaacaacagtcagctgctagagaagacgatgtaatgtcgagagttagaaca
gaaggaagcaggcaatggttgacccaggaagaagtgcactgttttcgcagtgcactggag
ggaaaacctgatggctcccctgagcgcccaggccctgctacttcggaaccaaccccaaac
ccatcagtgaccagccaacgtgagaagagagttgctagaccacccaaaaagaagtttcaa
aaggcgggactttactctgatgtgtacaagactgatgatcctcgcagtcagctgctacag
ttaaagaaagagaagctagaatacactccaggtgaacatgactatggccttcttcctgct
cccattcatgttgggaaatacttgagacagaaacgcattgatttccagctgccttacgac
atcctgtggctttggaaacatgatcagctctacaagagacctgacgtgcctctctacaag
aagatcagatccaatgtctatgtggatgtgaagcctctttctggctatgaagccactacc
tgtaactgcaggttgcctgacgactctagtgaaaagggctgtcaagatgattgtctaaac
aggatgatttatgccgagtgctctccaagtacgtgtccgtgttccgatcagtgcgataac
cagcggatccagaagcatgagtgggttcagtgcctcgagcgcttccgagctgagggaaag
ggctggggcatccggaccaagcagccccttcgtgccggccaatttatcatcgagtacttg
ggagaggtggtcagcgaacaagagttcagaaaatacattgcgtctgactgtaggttgcac
caagtcaaaattccaatgttgggggaaaataaaaagcagattggtgtgagtcgcatgatg
gagcagtacttctctcacagcggccactactgcctgaatctggacagcggcatggtcatc
gatagctaccgcatgggcaacgaggctcgctttgtcaaccacagctgcgagcccaactgt
gagatgcagaaatggtcggtgaacggagtgtaccgaattggcctgtttgctctaaaagac
atcaacagcggaacggaactgacatatgactacaacttccactccttcaacacagaggaa
caacaagtctgcaagtgtggctcagagggttgccgaggcatcattggcggcaagagcaag
cgaatcaatgggctgcctgctaaaggggccggatctggaggcggagcccggagacttgga
agattgaaagagaaacgcaagtccaaacactcactgaagaagcgggaggaagagtccagt
gacagcagcaagttttaccagcaccttttaatgaagcccatgtcaaacagagagaggaac
tttgtgctgaaacatcgggtctttctgctgcggaattgggagaagatgcgggagaaacag
gagcttctgaagcgtgagggagagcgggagagggagaacagcggtctgtctctgtacacc
cgctggggaggagtcatccgggatgatggaaacatcaaatcagatgtatttctgactcag
ttctcagcgctgcagacgtcccgctctgtacgcacacgcagacttgcggcagccgaggag
aacactgaagtgacacgcaccgcacgtctggcacacattttcaaagagatctgcgatatg
atcactagctacaaggattcatctggtcagcctcttgctgctccgctgcttaacctgcct
tctaggaagaggaacacacaatactatgagaaggtcaccgatcctctagatctcagcacc
atagataagcagatcctcagcggacactacaaaaccgatgaggcgtttgatgcggacatg
ctcaaagtgtttcgcaatgctgagaagtactatgggcgtaagtctgctgtgggccgtgac
gtgtgccggctgaggaaggcttattatggtgcccgtcatgaggctgctgttcagatcgat
gagattgtgggtgagacggcaagtgaagcggacagctctgattcgctggagagagaccac
gcccaccaccatcaccatgacggagggggcagccatgataaggatgatgatgtgatccgc
tgcatctgtggcatgtacaaggatgagggactcatgattcagtgcgagaagtgcatggtg
tggcagcactgtgattgtatgcgtctggaggcggatgtggagcattatctctgtgaacag
tgtgaccctcgtccagtggacagagaggttccaatggtgcctcaacccagctatgcccaa
tcaggattcatctattacatatgcctgcttcgcgatgacttactgttgcatcagggcgat
tgtgtgtacctcatgcgggacagcagacgcacaacagaaggtcagccggtgcgtcagtca
taccgcctcctgtctcacatcaacagagacaaactggacatcttccgtatcgagaaactc
tggaagaatgaaaaaggtgagaggtttgcatttggtcatcattacttccgtcctcatgag
acgcatcactccccttcccgccgcttctaccacaacgagctgtttcgagtgcctctgtat
gagatcatcccgctggaggccgtggtgggcacctgctgcgtgctggacctctacacatac
tgcaagggtcgtccaaaaggggtaaaggagcaggacgtttacatctgcgactaccggctg
gataaatccgcacacctgttctacaagatccaccgcaaccgttacccagtgtgcaccaag
ccctatgcgttcaaccacttccccaagagactgacgcccaagagggacttctctcctcac
tatgttccagataactacaagaggaacggcggacgctctgcttggaagagcgagcggccc
aaagatgaagaaccatcatcctccagcacgtcctgcgagcgtctgtcctccagcttccct
agagaaggagacgaggacggaggacgaggagcagaaggagacgcggaggccgctcaagag
ggatccagcactccgagacctcagagatcctcgccactggagagcaggacggccggagag
gaggatgaggcggaggaggaagaggacagagagaggaggagagagatgcaggaggaggag
gaggaggagggatgcagagagaaagcaggagcgcaggagcccatagacgcacagtgctcc
tcctccatctcctcttctcctcttcatcccgccattctgggcaggagagaagcgcagaga
gagcggctcaacaagatcctgctcgacctgctgcaccgcgcgcccactaagaacgcgata
gatgtgacgtatcttcttgaggaaggctcgggtcgtcgccttcgcagacggacgcttgga
ctgagcgaattcatttgcagaaagtaa

DBGET integrated database retrieval system