KEGG   Danio rerio (zebrafish): 563878Help
Entry
563878            CDS       T01004                                 

Gene name
pomt2, im:7153045, zPOMT2, zgc:158749
Definition
protein-O-mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    563878 (pomt2)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     563878 (pomt2)
Glycosyltransferases [BR:dre01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   563878 (pomt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 756 aa AA seqDB search
MDVRPKENFSQRQDTSAVRHRKTCKVNERAEIPSQPHNGTINGVNKRITKREGGERISSP
SRDAHVPVFILALVIVLSVSTRFYKITEPPHVCWDETHFGKMGSYYINRTFFFDVHPPLG
KMLIGLAGYLTGYDGTFPFIKPGDKYEHHNYWGMRAFCAALGSCLPPFAFLVVLELSQSS
TAALIAASLLIFDTGCITLSQYILLDPILMFFIMGSVLCMVKFNTQRLGPFSFSWWFWLL
LTGLCLSGSLGVKFVGLFVILLVGINTALDLWRLLGDLSLSLVDFGKHLLARVFGLIMLP
LFLYTTIFAIHFIVLNRSGPGDGFFSSAFQSRLIGNNPHNASMPEYLAYGSVITVKNLRI
AGGYLHSHWHLYPEGVGAHQQQVTAYLHKDYNNLWLVKRLDNSDDLTGSPELVRHGDIIR
LEHKETTRNLHSHFHEAPLTKKHLQVTGYGINGSGDVNDLWQVEVCGGRKGDPVKVLRSK
VRFLHRATGCVLCSSGKTLPKWGWEQVEVTCSPYVKETPNSQWNIEDHINPKLPNISLAV
LKPTFLEILWESHIVMIRGNSGLKPKDNEMSSKPWHWPINYQGLRFSGVNETEYRVYLLG
NPVIWWLNLLSLALFVILLTVASLAVQRRVKMEGMMKVHCHTLMEGGGMLFLGWLLHYLP
FYIMGRILYYHHYFPAMMFSSMLTGITLDILLQNLQLLFSSSLSHYLMRGGQSVLLLGFI
YSFYLFHPLSYGMRGPLAHDSASSMAGLRWMESWEF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagaccgaaggagaatttctctcaaagacaagacacatccgctgtaagacat
cgaaaaacatgtaaggtaaacgagagggctgagattccttcccagcctcacaatgggact
attaatggtgtaaataagaggatcaccaaacgagaaggaggagaacgcatcagttcaccc
agcagagatgctcatgtgcccgtttttattttggctctggtgatagtgttgtctgtatct
acacgcttttacaagatcactgagcctcctcatgtatgttgggatgagactcattttggg
aaaatgggaagctattacattaatcgcaccttcttctttgatgtccatccgccccttgga
aagatgctgatcggcctcgctggatacttgacaggttacgatgggacctttcccttcata
aagccaggggacaaatatgagcaccacaattactgggggatgagagcgttctgtgctgct
cttggttcctgtttgcctccttttgcctttcttgttgtcctggagctctctcagtcttca
acagcagcgctcatcgcagcctctctgctcatcttcgacactggttgcatcaccctgtct
cagtatatcctgctggatcccattctgatgtttttcatcatgggctcggttctgtgcatg
gtcaaattcaacacgcaaagactcgggcctttcagcttctcctggtggttctggctgctt
ctgacagggctatgcctctctgggtctcttggtgtaaagtttgtggggctgtttgtcatt
ctcttggttggaatcaacacagcgcttgatctttggagactgcttggggacctcagctta
tctctggtggattttgggaagcacttactagctcgagtttttgggttgataatgcttccg
ttgttcttgtacacgacaatattcgccattcatttcattgtcttaaacaggagtggtccc
ggagatggtttcttcagctctgcgtttcagtctcgcttgattggaaacaatccacacaac
gcctccatgccagagtatctggcatatggctcagtcataacagttaaaaatctgcgaatt
gcaggaggatatttgcactctcactggcacctttacccggagggggttggagctcaccag
cagcaggttactgcctatttacacaaagattataacaacctgtggttggtcaagagactt
gacaactctgacgatctcacaggctcaccagagctcgtccgtcatggtgacatcattaga
ctggagcataaagaaactacaagaaatcttcatagtcatttccatgaagcgcccctgacc
aaaaaacacctgcaggtcacaggttatggcattaatggaagtggtgacgtgaatgacctg
tggcaggtggaggtgtgtggaggaaggaagggagatccagtgaaggtgctgcgcagtaaa
gtgcgttttcttcatcgcgccacaggctgtgtgctctgctcctctggaaagacccttccc
aaatggggatgggagcaagtggaggtcacatgcagcccgtatgtcaaagagaccccaaat
tcgcagtggaacattgaggaccacatcaaccctaaactgcccaacatcagtcttgcagta
ctcaaacccactttcctggagatcctctgggagtctcatattgtgatgatcaggggaaac
agtggtttgaagcccaaagacaacgagatgagctctaaaccctggcactggcccattaac
tatcagggattaaggttttctggagtgaatgaaactgaataccgtgtttatctccttgga
aaccctgtcatttggtggctgaacttgttaagtctggctctatttgtaatcctgctgacg
gtggcttcattagccgtgcagagaagagtgaagatggagggaatgatgaaagtgcattgt
cacacacttatggagggtggcgggatgctgtttttgggttggctgttacactatctccca
ttctacatcatgggtcgcatactctactaccatcattactttcctgccatgatgttcagc
agtatgctaacaggtattactctggacatcctccttcagaatttgcagcttctctttagc
tcatctttatctcattacctgatgaggggaggtcagtcggtgctcctcttagggtttatc
tacagcttttatcttttccaccctctctcctatggcatgagagggccgctggcacatgac
tctgcctcctccatggccggtctcaggtggatggaatcctgggagttttag

DBGET integrated database retrieval system