KEGG   Danio rerio (zebrafish): 563942Help
Entry
563942            CDS       T01004                                 

Gene name
kat2b, pcaf, si:ch211-1j13.2, zgc:161980
Definition
K(lysine) acetyltransferase 2B (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dre04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
19
AA seq 796 aa AA seqDB search
MSESTGIPQGSPAVGAAGSAPAAPGVGGTECSGAAVGSARIAVKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPTAVSLMEPCRSCSHALGDHVTHL
ENVSEEEMNRLLGIVLDVEYLYTCVHKEEDPDTKQVYFSLFKLLRKCILQMGRPVVEALE
SPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQKRQRAPD
DDVAGYKVNYTRWLCYCNVPQFCDSLPRYEATQIFGRIFLRSVFTIMRKQLLEQARQEKD
KLPPEKRTLILTHFPKFLSMLEEEVYSHNSPIWSENFMIGLSGGQIPTVVSAPPVNRSLY
YSSSPAPVELAGGGSVSPARKTASVLEPNPGGEKRKPAEPLSHEDSKRPRVVGDIPMELI
NEVMSTITDPTAMLGPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPTQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYV
GYIKDYEGATLMGCELNPCIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEG
VRQIAIESIPGIRETGWKPLGKSKELKDPDQLYSTLKNILTQVKSHPNAWPFMEPVKKNE
APGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLL
EKFFYTKIKEAGLIDK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaagcacggggatccctcagggctccccggcggtgggcgcggcaggctcggct
ccggctgctccaggagtcggtggaaccgagtgttcgggcgctgctgtcggttctgcacgt
atcgccgtcaagaaggcgcagctccgctcctccccgcgtccgaagaaactggagaaactc
ggcgtttattcctcgtgcaaggctgaaggagcttgtaagtgtaatggctggaagagtcaa
aaccctccccctactccgcctcctccaaccccacccagggctgagcaaccaaccgctgtc
agcctaatggagccatgcagaagctgcagccacgccctcggtgaccatgtgacgcacctg
gagaatgtgtcagaagaggagatgaacagactgcttgggattgtactggatgtggagtac
ttgtacacgtgtgtccataaagaggaggatcctgacactaaacaagtttacttctctctc
ttcaaactgctaaggaaatgcatcctgcagatgggaaggccagtggtggaggctctggaa
agcccgccttttgaaaaaccaagcatcgagcagggtgtgaacaactttgtgcagtacaag
tttagccaccttccgtctaaggaaagacaaaccattgtggagctcgcaaagatgttcctc
aaccagatcaactactggcagctagaaacgccctcacaaaaaagacaaagagcaccagat
gatgatgtagctggttataaagtcaattacaccaggtggctgtgttattgtaacgtgccc
cagttctgtgacagtctcccaaggtacgaggccacacagatttttggacgcattttcctg
cgctctgtgttcaccataatgagaaagcagctgctggaacaggcccgccaggagaaagac
aaactaccacctgagaaacgcacactcattcttacacatttccccaagtttttgtctatg
ctggaggaagaggtttatagtcataattcgcccatctggagtgaaaacttcatgattggt
ttatcaggcggacagattccaacagtggttagtgctccacctgtgaatcgctccctgtac
tacagcagcagtccagcaccagtggagctggctggaggaggaagtgttagcccggcccgg
aaaacagcttctgtccttgaacccaatccaggtggagaaaagcgaaagccagctgagcca
ttatctcatgaggacagcaaacggcctcgtgtggttggtgacattcctatggaattaatt
aatgaagtcatgtctaccattacagaccctactgccatgctgggaccagagaccagtctt
ctctcagctcattcagcacgtgatgaagctgctcgattagaggagagacgaggcgtcatc
gagttccacgtcattggaaactccctcaaccaaaagcccaataagaagatccttatgtgg
cttgttggcctgcagaacgtcttctcacaccaactgcctcgcatgcctaaagaatacatc
acaagactcgtctttgacccgaagcacaagaccctctctctgatcaaagatggccgtgtc
attgggggaatctgcttccggatgtttcctactcagggcttcactgagattgtgttttgt
gctgtcacctccaatgagcaagtgaagggttatgggactcatctcatgaaccatctaaag
gaatatcacatcaagcatgaaatcctcaactttctcacctatgctgatgagtacgccatt
ggctacttcaaaaaacagggattctctaaagacattaaagtgccgaagtcaaagtatgtg
ggctacattaaagactatgagggggccacactaatgggctgtgagctgaatccctgcatc
ccttacactgagttctcggtcatcatcaagaaacagaaagagatcattaagaagcttata
gagcgcaagcaagcccagattcgcaaagtctacccaggactgtcctgtttcaaggaggga
gttcggcagattgccatcgagagcattccaggaatccgtgagactggctggaagccttta
gggaaaagcaaagaactgaaggatccagatcagttgtacagcactttaaagaacatctta
acacaggtcaagtcacatccaaatgcatggccattcatggagcctgtaaagaagaatgag
gcgcccgggtattaccaagtcatccgcttccctatggacctgaagacgatgagcgagcgg
ctgaaaagtcgttactacaccacgaggaagctgttcatggccgacatgcagaggatcttc
actaactgtcgagaatacaaccctcctgaaagcgagtactacaaatgtgccaatctacta
gagaagttcttctacaccaagatcaaggaggcaggcctcatcgacaagtaa

DBGET integrated database retrieval system