KEGG   Danio rerio (zebrafish): 563942Help
Entry
563942            CDS       T01004                                 

Gene name
kat2b, pcaf, si:ch211-1j13.2, zgc:161980
Definition
(RefSeq) K(lysine) acetyltransferase 2B (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    563942 (kat2b)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     563942 (kat2b)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     563942 (kat2b)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    563942 (kat2b)
   HAT complexes
    PCAF complex
     563942 (kat2b)
    STAGA complex
     563942 (kat2b)
    TFTC complex
     563942 (kat2b)
    SAGA complex
     563942 (kat2b)
    SLIK complex
     563942 (kat2b)
    ADA-HAT complex
     563942 (kat2b)
    HAT-A2 complex
     563942 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
19
AA seq 796 aa AA seqDB search
MSESTGIPQGSPAVGAAGSAPAAPGVGGTECSGAAVGSARIAVKKAQLRSSPRPKKLEKL
GVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPTAVSLMEPCRSCSHALGDHVTHL
ENVSEEEMNRLLGIVLDVEYLYTCVHKEEDPDTKQVYFSLFKLLRKCILQMGRPVVEALE
SPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQKRQRAPD
DDVAGYKVNYTRWLCYCNVPQFCDSLPRYEATQIFGRIFLRSVFTIMRKQLLEQARQEKD
KLPPEKRTLILTHFPKFLSMLEEEVYSHNSPIWSENFMIGLSGGQIPTVVSAPPVNRSLY
YSSSPAPVELAGGGSVSPARKTASVLEPNPGGEKRKPAEPLSHEDSKRPRVVGDIPMELI
NEVMSTITDPTAMLGPETSLLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKKILMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIKDGRVIGGICFRMFPTQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYV
GYIKDYEGATLMGCELNPCIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEG
VRQIAIESIPGIRETGWKPLGKSKELKDPDQLYSTLKNILTQVKSHPNAWPFMEPVKKNE
APGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLL
EKFFYTKIKEAGLIDK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaagcacggggatccctcagggctccccggcggtgggcgcggcaggctcggct
ccggctgctccaggagtcggtggaaccgagtgttcgggcgctgctgtcggttctgcacgt
atcgccgtcaagaaggcgcagctccgctcctccccgcgtccgaagaaactggagaaactc
ggcgtttattcctcgtgcaaggctgaaggagcttgtaagtgtaatggctggaagagtcaa
aaccctccccctactccgcctcctccaaccccacccagggctgagcaaccaaccgctgtc
agcctaatggagccatgcagaagctgcagccacgccctcggtgaccatgtgacgcacctg
gagaatgtgtcagaagaggagatgaacagactgcttgggattgtactggatgtggagtac
ttgtacacgtgtgtccataaagaggaggatcctgacactaaacaagtttacttctctctc
ttcaaactgctaaggaaatgcatcctgcagatgggaaggccagtggtggaggctctggaa
agcccgccttttgaaaaaccaagcatcgagcagggtgtgaacaactttgtgcagtacaag
tttagccaccttccgtctaaggaaagacaaaccattgtggagctcgcaaagatgttcctc
aaccagatcaactactggcagctagaaacgccctcacaaaaaagacaaagagcaccagat
gatgatgtagctggttataaagtcaattacaccaggtggctgtgttattgtaacgtgccc
cagttctgtgacagtctcccaaggtacgaggccacacagatttttggacgcattttcctg
cgctctgtgttcaccataatgagaaagcagctgctggaacaggcccgccaggagaaagac
aaactaccacctgagaaacgcacactcattcttacacatttccccaagtttttgtctatg
ctggaggaagaggtttatagtcataattcgcccatctggagtgaaaacttcatgattggt
ttatcaggcggacagattccaacagtggttagtgctccacctgtgaatcgctccctgtac
tacagcagcagtccagcaccagtggagctggctggaggaggaagtgttagcccggcccgg
aaaacagcttctgtccttgaacccaatccaggtggagaaaagcgaaagccagctgagcca
ttatctcatgaggacagcaaacggcctcgtgtggttggtgacattcctatggaattaatt
aatgaagtcatgtctaccattacagaccctactgccatgctgggaccagagaccagtctt
ctctcagctcattcagcacgtgatgaagctgctcgattagaggagagacgaggcgtcatc
gagttccacgtcattggaaactccctcaaccaaaagcccaataagaagatccttatgtgg
cttgttggcctgcagaacgtcttctcacaccaactgcctcgcatgcctaaagaatacatc
acaagactcgtctttgacccgaagcacaagaccctctctctgatcaaagatggccgtgtc
attgggggaatctgcttccggatgtttcctactcagggcttcactgagattgtgttttgt
gctgtcacctccaatgagcaagtgaagggttatgggactcatctcatgaaccatctaaag
gaatatcacatcaagcatgaaatcctcaactttctcacctatgctgatgagtacgccatt
ggctacttcaaaaaacagggattctctaaagacattaaagtgccgaagtcaaagtatgtg
ggctacattaaagactatgagggggccacactaatgggctgtgagctgaatccctgcatc
ccttacactgagttctcggtcatcatcaagaaacagaaagagatcattaagaagcttata
gagcgcaagcaagcccagattcgcaaagtctacccaggactgtcctgtttcaaggaggga
gttcggcagattgccatcgagagcattccaggaatccgtgagactggctggaagccttta
gggaaaagcaaagaactgaaggatccagatcagttgtacagcactttaaagaacatctta
acacaggtcaagtcacatccaaatgcatggccattcatggagcctgtaaagaagaatgag
gcgcccgggtattaccaagtcatccgcttccctatggacctgaagacgatgagcgagcgg
ctgaaaagtcgttactacaccacgaggaagctgttcatggccgacatgcagaggatcttc
actaactgtcgagaatacaaccctcctgaaagcgagtactacaaatgtgccaatctacta
gagaagttcttctacaccaagatcaaggaggcaggcctcatcgacaagtaa

DBGET integrated database retrieval system