KEGG   Danio rerio (zebrafish): 564004Help
Entry
564004            CDS       T01004                                 

Gene name
usp45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     564004 (usp45)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   564004 (usp45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 803 aa AA seqDB search
MRLKDPFSLKTADMTKRSNKPKKPRDEDSSDEVGGLTCQHVSRAVDLSSVKKAVTGSLWS
VCSDCLKERNVLEGETAGAHDILVCLKCGFQGCNQAEVQHSTKHQQAHHSDSHCITISLT
TWKAWCFECKEELSTHCNKKALAQTLDFLQKQSAKATSGTSSKLIKLREEPAEYVDTQRG
KSPVNSTLIPVKGINNLGNTCFFNAVMQNLSQTHMLNDLIQDVKEKGHKMKISPSTETNL
GSLTVTLPSPEPLTSAMFLFLQSMKESGKGPVSPKILFNQLCQKAPRFKGYQQQDSQELL
HYLLDSMRVEETKRIKAGILKAFNNPTEKTADEETKRQVKAYGKEGVKLNFVDRIFVGEL
TSTIMCEECEHISTVKEAFIDISLPIIEERISKPTNPARLGKSGREQDSLTSHDDSLAAH
SQANRNSRRLSGQKLQSRHSSTSHDDRGPDTVSSRQEEDLCVAGRGLSSYRTDTMGSQSD
CSEKESNLQDSSNDADSEASESEWSPRIPSVSSHSSTSDKTSITTTLSTTTHNPSLKSNP
SSTPLPSIRPQQGGAVEQLVSAVSKLGLVHTSTDTLPISHSQEELSETRDRDRQHHQGAF
QVLCHSYTPSSKECSVQSCLHQFTSIELLMGNNKLLCENCTDRRQRQMKRSDKKAEKVYT
SARKQMLISALPPVVTLHLKRFHQAGMNLRKVNRHVDFPLLLDLAPFCSATCKNLGSGER
VLYSLYGIVEHSGSMRGGHYAAYVKVRTPQRKPEQRRNQSGSREACSAPQGQWVYVSDTT
VQTVPESRVLNSQAYLLFYEELL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgcggttgaaagaccccttctctttaaaaaccgcagacatgaccaagcggtctaacaag
ccaaaaaaacctcgcgatgaagactcatctgacgaggttggcggtctgacgtgccagcat
gtgagcagagctgtggacctgagctcagtaaagaaggcagtgacgggcagcctgtggtct
gtgtgctctgactgccttaaagagaggaacgtgctggagggagaaacggcaggagcacat
gacatccttgtgtgcctcaagtgtggcttccagggctgcaaccaagcagaagttcagcat
tccacaaaacaccagcaagctcatcactcagactctcactgtatcaccatcagcctcact
acatggaaggcctggtgctttgaatgtaaggaagagctgtccactcactgcaataagaaa
gcattggctcagactctggactttctgcaaaagcagtcagcaaaagccacctcaggaaca
tcctcaaaactcatcaagctccgagaggaacccgctgaatatgtggacactcagagaggg
aagagtccagtcaatagcacacttatcccagtcaagggcatcaacaacctgggcaacacc
tgcttcttcaatgctgtgatgcagaatctctctcagacccacatgctgaatgacctgatt
caagatgtcaaggagaaaggacataagatgaagatcagcccctccactgagactaacttg
gggtcgctgactgtgacgttgcccagccctgaacccctcacctcagccatgttcctgttc
ctccaaagcatgaaggaatctggaaaagggcctgtatctcccaagatccttttcaaccag
ctctgtcagaaggctcctcgttttaagggttaccagcagcaggacagtcaggaattgctg
cattacctcctggactctatgagagtggaggagacaaagcgcattaaagcggggatcctt
aaagcctttaacaaccccacagagaagactgcagacgaggagaccaaacgacaagtgaag
gcttatggaaaagaaggagtgaaattaaattttgttgatcgaatctttgtcggagagctg
accagcaccataatgtgtgaagagtgtgagcatatttctacagtgaaggaagcctttatt
gacatttctcttcccatcattgaggaaaggatttcaaagcccacaaaccctgctagactg
ggcaaaagtgggcgggaacaagacagtctgacctcccatgatgactcattagctgcccac
tcccaggccaatcgaaacagcaggaggctcagtggacagaagctacagagccgccattcg
tccacgtctcatgatgaccgaggcccagacactgtttctagccgtcaagaggaggatctc
tgtgtggctggccgtggcctatccagttacaggactgatacaatgggcagccagtcagac
tgcagtgaaaaagagtcaaacctgcaggacagcagtaacgatgcagacagcgaggcctct
gaaagtgaatggtctccccgaatcccatcagtgtccagtcacagcagcacatcagataaa
acctcaatcaccacaactctatccacaacaacacacaatccaagtttaaaatcgaaccca
agctccactccattaccctccattaggccccagcagggcggcgctgtggagcagcttgtc
agcgctgtgtccaaactgggcctggttcacacatccactgatactctacccatcagccac
agccaagaggagctgagtgagacccgggacagagaccgtcaacaccatcaaggggccttt
caagtcctctgtcacagctacacccccagctcaaaagagtgctctgtccagtcctgcctt
catcagtttacctctattgagctgcttatgggaaacaacaagctgctctgtgaaaactgc
actgacaggaggcagaggcagatgaagaggagcgataagaaggcagagaaggtgtacacc
agtgcccgtaaacagatgctcatatctgcacttcctccagtcgtcactcttcacctcaaa
cgctttcaccaggctgggatgaatctgaggaaagttaatagacatgtggactttcctctt
ttgctggacctggcacctttttgctccgccacttgtaagaacctcgggtcaggagagcgt
gtgctttacagtttgtatggcattgtggagcacagtggatcgatgcgaggtgggcattat
gcagcctatgtaaaggtccgaacacctcaacgtaaacctgagcagcgccggaaccagtca
ggttcccgagaggcctgttcagctccacaaggtcagtgggtatatgtcagcgacaccact
gtacagactgtccctgagtccagagtgctgaactctcaagcttatttacttttctatgaa
gaactgctatag

DBGET integrated database retrieval system