KEGG   Danio rerio (zebrafish): 564054Help
Entry
564054            CDS       T01004                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     564054
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   564054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 398 aa AA seqDB search
MPSIRQSYTVTVPEEPPASAFPFIKQDMRRKSPTMSRSMLVSTFVGLLINQAKNSKNAQG
LVGLRNLGNTCFMNSILQCLSNTHDLRDYCLRNTHRTDLNNNCRAKAALMDEFAKLTQTI
WTSASNEAISPSDFKMQIQKYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVKSRAPVE
DLDHLSEDEKGKRMWNKYLESEDSKVVDLFVGQLKSSLTCSECGFCSTVFDPFWDLSLPI
AKTSGEVSLNDCLRLFTKEDVLDGNERPTCHRCKTRRKCTKKFTIQKFPKILVLHLKRFS
ECRVRTSKLSTFVNFPLKELDLREFASDNSVNAVYNLYAVSNHTGTSLGGHYTAYCRSPC
TGEWYTYNDSRVSPMSSSQVCSSDAYVLFYECATSSRM
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtatacgacaatcttacacggtcactgtcccggaggaaccgccggcttcggct
ttccccttcatcaagcaggatatgcgcagaaaaagtccgacaatgtctcgctctatgctg
gtgtccacatttgtggggcttctcattaaccaggctaagaactcaaagaatgctcagggt
ctggtgggtctcaggaatctcggaaatacttgtttcatgaactccatcctgcagtgtctg
agcaacactcatgacctgagggactactgtctgcgtaacacacaccgcaccgacctcaac
aacaactgcagggccaaagctgcgctgatggacgagtttgccaagctcactcagaccatt
tggacgtcagctagcaatgaggccatcagcccttctgactttaaaatgcagattcagaaa
tacgcccctcgatttgttggttacaatcagcaggacgctcaggagttcttgcgctttcta
ctggatgggctccataatgaagtaaaccgagtgacggtgaaatccagagcacccgtggag
gatcttgatcacctctcggaggacgagaaaggcaagcgaatgtggaacaagtacctggag
agcgaggacagcaaagtagtcgatctgttcgtcggtcaactcaaaagctcattgacgtgc
agcgagtgtgggttctgctcaactgtattcgatccgttctgggatctgtctctgcctata
gctaagacttcaggagaagtaagtttgaatgattgtcttcggcttttcaccaaggaggat
gtacttgatgggaatgagagaccaacatgccacagatgtaaaaccagacggaaatgcacg
aaaaagttcaccattcagaaatttcccaaaatcctggtgcttcatctaaagcgtttctcg
gagtgtcgggtcagaaccagcaaactctccacatttgtaaacttccctctcaaagagctg
gacctcagggaattcgcctctgataacagcgtaaatgcagtgtataatctgtatgccgtg
tccaatcacactggtacatcattgggtggtcattatacagcgtactgccgcagtccctgt
acaggagaatggtacacatacaatgactccagggtgagccccatgtcgtccagccaggtg
tgcagcagcgacgcttacgtgctcttctacgagtgtgcgacctcctcgcgcatgtga

DBGET integrated database retrieval system