KEGG   Danio rerio (zebrafish): 564064Help
Entry
564064            CDS       T01004                                 

Gene name
prkacaa, zgc:158799
Definition
protein kinase, cAMP-dependent, catalytic, alpha, genome duplicate a (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    564064 (prkacaa)
   04310 Wnt signaling pathway
    564064 (prkacaa)
   04340 Hedgehog signaling pathway
    564064 (prkacaa)
   04020 Calcium signaling pathway
    564064 (prkacaa)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    564064 (prkacaa)
   04210 Apoptosis
    564064 (prkacaa)
  Cell communication
   04540 Gap junction
    564064 (prkacaa)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    564064 (prkacaa)
   04912 GnRH signaling pathway
    564064 (prkacaa)
   04914 Progesterone-mediated oocyte maturation
    564064 (prkacaa)
   04916 Melanogenesis
    564064 (prkacaa)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    564064 (prkacaa)
   04270 Vascular smooth muscle contraction
    564064 (prkacaa)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     564064 (prkacaa)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   564064 (prkacaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 352 aa AA seqDB search
MGNAPTAKNKGNEMESVKEFLAKAKEDFLKKWENPAQNTASLDHFERLKTLGTGSFGRVM
LVKHKESGQHFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEHSFKDNTNLYM
VMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQG
YIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPF
FADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKGHKWFA
TTDWIAIYQKKVEAPFIPKCKGPGDTSNFDDYDEEEIRVSITEKCGKEFAEF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcgcccaccgccaagaacaagggcaatgagatggagagcgttaaggagttt
ctcgctaaagccaaagaagatttcctaaagaaatgggagaacccagcacagaacactgcg
tctctggaccattttgagcggttgaagacgctgggcaccggctcctttggacgagtcatg
ctagtcaagcacaaagaatcaggccagcattttgccatgaagatcctcgacaaacagaag
gtggtgaagctgaaacagatagaacacacactgaatgagaaacgcatcctgcaggctgtc
agcttcccctttcttgtgcgattggagcattctttcaaggataatactaacctgtatatg
gtaatggagtatgttcctggaggagagatgttttctcacttacgtagaatcggaagattt
agtgagcctcatgcccgattttacgccgcccaaatagttctgacctttgaataccttcac
tcactcgatctcatctaccgagatctgaagcctgaaaacctgctcatagaccagcagggc
tacatacaggtgacagattttggatttgctaaacgtgtaaagggcaggacctggacactg
tgtggcacacctgagtacctggcaccagaaatcatcctcagtaaaggctataataaagct
gtggactggtgggctctgggagtgctgatctacgagatggctgctggttacccgccattc
tttgctgaccagcctatccagatctacgagaaaattgtctccgggaaggtccgctttcct
tcacattttagctctgaccttaaggatctgctgaggaacctgctgcaggtcgatctgacg
aaacgcttcgggaacctgaagaacggcgtcaacgacatcaagggccacaaatggtttgca
accaccgactggattgcaatctaccagaagaaggtggaagccccgttcatccctaagtgc
aaaggccccggggacaccagcaacttcgacgactacgacgaggaagaaatccgggtctct
atcacggagaaatgtggaaaggagtttgctgaattctag

DBGET integrated database retrieval system