KEGG   Danio rerio (zebrafish): 564147Help
Entry
564147            CDS       T01004                                 

Gene name
glsa
Definition
(RefSeq) glutaminase a
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00220  Arginine biosynthesis
dre00250  Alanine, aspartate and glutamate metabolism
dre00471  D-Glutamine and D-glutamate metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    564147 (glsa)
   00220 Arginine biosynthesis
    564147 (glsa)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    564147 (glsa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     564147 (glsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 564147
NCBI-ProteinID: NP_001038509
ZFIN: ZDB-GENE-050204-3
Ensembl: ENSDARG00000062812
Vega: OTTDARG00000009521
UniProt: Q1LWI2
Position
22
AA seq 591 aa AA seqDB search
MLHFRLSRALKEICKPNVRRVWRNNTDETTVAGGRASSSRRALCTQTDAANDKRRKAGIL
PSLEDLLFYTIAEGQEKIPAHKFTTALKATGLRTGDPRLKECMEMLKITLKTTSDGALDR
HLFKKCVQSNIVLLTQAFRKKFVIPDFQSFTSHIDQIYESAKSLSGGQVADYIPQLAKFS
PNLWAVSLCTVDGQRYTAGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLR
FNKLFLNEDDKPHNPMVNAGAIVCTSLLKQGVSNAEKFDYVLNFMKKLAGNEYVGFSNAT
FQSERLSGDRNFAIGYYLKEKKCFPEGTDMISILDLYFQLCSIEVTCESASVMAATLANG
GFCPITGERVVNPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMG
IMCWSPPLDKLGNSVRGIQFCTDLVQLFNFHNYDNLRHFAKKLDPRREGGDQRVKSVINL
LFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVAAAEGHAEVVRFLLEACKVNPVPKD
RWGNTPMDEAIHFGHHDVVTILQDYHNTYSPKESSADSEKETAEKNLDGML
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgttacactttaggctttcgagggcgttaaaggagatctgcaaacccaatgtaaggcgc
gtttggagaaataatacagatgaaacaacggtcgccggaggacgcgcatcttcatccaga
cgagctctgtgcacgcagacagatgcggccaatgacaagagaaggaaggcaggcattttg
cccagcctggaagatctactgttttacactatcgcagaaggccaggagaaaattccagct
cacaagtttaccacggcgctgaaagccacaggtctgcgaactggagaccctcgtcttaag
gaatgtatggagatgttaaagatcaccctgaaaaccacttcagacggtgctctggatcga
catctctttaaaaagtgtgtgcaaagtaacatcgtgctgctaactcaggctttccggaag
aagtttgtcattcctgactttcagtcgtttacctctcatattgatcagatttatgagagt
gctaaatcactgtcaggtggccaggtagcagattacattcctcagctagcgaaatttagc
cctaacctctgggctgtttctctctgcactgtagacggtcaaagatacactgcaggcgac
actaaagttccattttgtctgcagtcgtgcgtgaaaccgctaaaatacgcaattgcggtt
cacgatcacggcaccgaatacgtgcaccgctttataggaaaggaacccagcggtcttcgt
ttcaacaaactcttccttaatgaagatgataaaccccacaatcccatggtaaacgctggc
gctatagtttgtacctccctactcaagcaaggtgtaagcaacgcagagaagtttgactat
gtgttgaatttcatgaagaagttggcaggaaatgaatatgttggtttcagcaatgctact
tttcagtcagagcgattgtcaggagacagaaactttgccattggatactacttgaaggag
aagaagtgtttcccagagggcaccgatatgatctccatcctggacctttactttcagctg
tgttccattgaggtgacctgtgaaagtgccagtgttatggcagcaactctggcgaacggc
ggcttctgtccaatcacaggcgagcgagtggtcaaccccgaggctgtgcgaaacactctg
agcctcatgcactcctgcggcatgtacgacttctctggacagttcgctttccatgttggt
ctgccggctaaatcaggtgtttctggaggcatcctgctggtcgtgcccaacgtgatggga
atcatgtgctggtctccacctcttgacaaactgggcaacagcgtgaggggaatccagttt
tgcacggatctggtccaactgtttaatttccacaactatgacaatttgcggcactttgcc
aagaaactggatccacgcagagagggcggagaccaacgggtcaagtctgtcatcaacttg
ctgtttgcggcctacacaggggacgtgtctgctttgagaaggtttgccttgtcatcgatg
gatatggagcagagagattatgactcgagaactgctcttcatgtagctgctgctgaaggc
catgctgaggttgtgcgttttctgctagaagcctgtaaagtgaatccagtgcccaaggac
aggtggggaaacactccgatggatgaagccattcattttggccatcacgatgtggtaaca
atcctgcaggactatcacaacacctacagcccgaaggagagcagcgccgacagcgaaaaa
gagacggcagagaaaaaccttgacgggatgctgtag

DBGET integrated database retrieval system