KEGG   Danio rerio (zebrafish): 564147Help
Entry
564147            CDS       T01004                                 

Gene name
glsa, glsl
Definition
glutaminase a
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    564147 (glsa)
   00330 Arginine and proline metabolism
    564147 (glsa)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    564147 (glsa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     564147 (glsa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 591 aa AA seqDB search
MLHFRLSRALKEICKPNVRRVWRNNTDETTVAGGRASSSRRALCTQTDAANDKRRKAGIL
PSLEDLLFYTIAEGQEKIPAHKFTTALKATGLRTGDPRLKECMEMLKITLKTTSDGALDR
HLFKKCVQSNIVLLTQAFRKKFVIPDFQSFTSHIDQIYESAKSLSGGQVADYIPQLAKFS
PNLWAVSLCTVDGQRYTAGDTKVPFCLQSCVKPLKYAIAVHDHGTEYVHRFIGKEPSGLR
FNKLFLNEDDKPHNPMVNAGAIVCTSLLKQGVSNAEKFDYVLNFMKKLAGNEYVGFSNAT
FQSERLSGDRNFAIGYYLKEKKCFPEGTDMISILDLYFQLCSIEVTCESASVMAATLANG
GFCPITGERVVNPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMG
IMCWSPPLDKLGNSVRGIQFCTDLVQLFNFHNYDNLRHFAKKLDPRREGGDQRVKSVINL
LFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVAAAEGHAEVVRFLLEACKVNPVPKD
RWGNTPMDEAIHFGHHDVVTILQDYHNTYSPKESSADSEKETAEKNLDGML
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgttacactttaggctttcgagggcgttaaaggagatctgcaaacccaatgtaaggcgc
gtttggagaaataatacagatgaaacaacggtcgccggaggacgcgcatcttcatccaga
cgagctctgtgcacgcagacagatgcggccaatgacaagagaaggaaggcaggcattttg
cccagcctggaagatctactgttttacactatcgcagaaggccaggagaaaattccagct
cacaagtttaccacggcgctgaaagccacaggtctgcgaactggagaccctcgtcttaag
gaatgtatggagatgttaaagatcaccctgaaaaccacttcagacggtgctctggatcga
catctctttaaaaagtgtgtgcaaagtaacatcgtgctgctaactcaggctttccggaag
aagtttgtcattcctgactttcagtcgtttacctctcatattgatcagatttatgagagt
gctaaatcactgtcaggtggccaggtagcagattacattcctcagctagcgaaatttagc
cctaacctctgggctgtttctctctgcactgtagacggtcaaagatacactgcaggcgac
actaaagttccattttgtctgcagtcgtgcgtgaaaccgctaaaatacgcaattgcggtt
cacgatcacggcaccgaatacgtgcaccgctttataggaaaggaacccagcggtcttcgt
ttcaacaaactcttccttaatgaagatgataaaccccacaatcccatggtaaacgctggc
gctatagtttgtacctccctactcaagcaaggtgtaagcaacgcagagaagtttgactat
gtgttgaatttcatgaagaagttggcaggaaatgaatatgttggtttcagcaatgctact
tttcagtcagagcgattgtcaggagacagaaactttgccattggatactacttgaaggag
aagaagtgtttcccagagggcaccgatatgatctccatcctggacctttactttcagctg
tgttccattgaggtgacctgtgaaagtgccagtgttatggcagcaactctggcgaacggc
ggcttctgtccaatcacaggcgagcgagtggtcaaccccgaggctgtgcgaaacactctg
agcctcatgcactcctgcggcatgtacgacttctctggacagttcgctttccatgttggt
ctgccggctaaatcaggtgtttctggaggcatcctgctggtcgtgcccaacgtgatggga
atcatgtgctggtctccacctcttgacaaactgggcaacagcgtgaggggaatccagttt
tgcacggatctggtccaactgtttaatttccacaactatgacaatttgcggcactttgcc
aagaaactggatccacgcagagagggcggagaccaacgggtcaagtctgtcatcaacttg
ctgtttgcggcctacacaggggacgtgtctgctttgagaaggtttgccttgtcatcgatg
gatatggagcagagagattatgactcgagaactgctcttcatgtagctgctgctgaaggc
catgctgaggttgtgcgttttctgctagaagcctgtaaagtgaatccagtgcccaaggac
aggtggggaaacactccgatggatgaagccattcattttggccatcacgatgtggtaaca
atcctgcaggactatcacaacacctacagcccgaaggagagcagcgccgacagcgaaaaa
gagacggcagagaaaaaccttgacgggatgctgtag

DBGET integrated database retrieval system