KEGG   Danio rerio (zebrafish): 564261Help
Entry
564261            CDS       T01004                                 

Definition
(RefSeq) si:rp71-17i16.5
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    564261
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    564261
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    564261
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     564261
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    564261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
23
AA seq 1069 aa AA seqDB search
MENSWEGVRDIQPEPCSDNNLVFICKLPAREGFQSVDSREPLQIKLPGQCSVHQLRVRLC
MLAQENNRISEPFALLDPERYSLLYHKEEEWYEIYDDFQVLQTLDAPWFQGTDGLQTVFV
TVLAQKSASEERVYFQHVLNELIGYDLDSSNANRLGELAYTRRKFATPRTQELKKRDLIA
YATEPWTTSIVLPNDQQGYFQRTLSVTLYYNGSNLSIKADLTQKPSDILKIFWESLPKGS
LPIESWTSDHVLKVCGREEFLSGDFQLSNYLWVRHCLKNSLELHLSVVAISSLPDDTVST
EYWPLVDSLTGLSSSHEELCLKKKEVEDIVLISLWDCERKFRVKLLGFDIPDLPSKVPSL
VYVEATIIYGKKTISSICSTPKEFTDEVLWNTWLEFDILIRDIPQGAKLGLTINATEAAK
ETKSSSSKVPDHHKGKLQVLYFVNLQLIDHRSLLSQGPHTLNMWPFPEWDEEAVTYEADK
LSTATNPDVANSMAITFMLDRYSFPVVLPNGRSSSCSGTSPVSESSSLDLAGESRLSAPF
SEASSTATLTRMRNLKKFKEESVHYVSNLPQFLRTVNWMLPTVVQEVHWLLSHWGPEDIE
LFVALELLSVDFADLKVRRLAVQRLEILSNDEVLKYLLQLVQTLKVEPYHDSFLARFLLK
RALRSKRIGHFFFWYLRSEVAGCPFFRQRMAVILEAYLLGCGEAMLAEFQSQVQVVSYLH
DVALAVKLLYPDRTDLPSTAPQKLQELLEKCDLPSDFQVPFDPRVRAGSIILKDCKIMAS
KKKPLWLEFSCIQSEAPPSPPVGIIFKHGDDLRQDMLIIQTLVVMDSIWQEKGLDLNLVP
YGCISTGFNIGMIEIVRNAITIASVQRSQGGVAGAFKNNALYDWLQTKCPFQEKHFQATE
KFVNSCAGYCVATYVLGIGDRHNDNIMITDQGNLFHIDFGHILGNTKSFWGVNRERVPFV
LTPDFLYVMGRVKGRPSLYFQRFRDTCINAYLSLRAQSRLLVTLFSLMLLTGIPELSMSQ
DMLYLRTALQQDQSEEEARNHLLQQIALCEHKGWTVQANWWFHLMAGIK
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagctgggaaggtgtgcgggatatacaaccggagccttgctcagataacaac
cttgtattcatttgcaagttaccagccagagaaggttttcagtcagtggacagcagggag
cccttacagatcaaactcccaggacaatgcagcgtacatcagcttcgagtgcgactttgt
atgctagcacaggagaataaccgaatatctgaaccatttgcacttctggacccagaacga
tacagtctgctgtaccacaaggaggaagagtggtatgaaatttatgacgactttcaggta
ttgcaaactcttgatgcaccctggtttcagggtactgatggtcttcagactgtctttgtt
actgtgctggctcagaaatctgcctcagaggagagagtttatttccagcatgttttgaat
gaactaattgggtatgatttagactcttcaaatgctaatcgtttaggtgagcttgcctat
actcgaagaaagtttgccacgccacgaacccaagaactgaaaaaacgagatctaatagct
tatgccactgaaccctggacaacttccatcgtgctcccaaatgatcagcaaggctacttt
cagcggacactttcagtgactctttattataatggttcaaatctttcgattaaagctgat
ttgactcaaaaacccagtgatatcctcaagatcttttgggaatcattgccaaaggggagc
ctaccaattgaaagctggaccagtgatcatgtcctcaaggtgtgtggcagggaggaattt
ctgagtggagacttccagctctcaaactacctgtgggtcagacactgcctcaaaaactca
ctggagcttcatctctcagtagttgccatctcatctcttccagatgacacagtgagtaca
gagtactggccactagtggacagtcttactggtctctcaagctcccatgaggagctctgc
cttaaaaaaaaggaagtagaggacattgtgctgatttctctgtgggactgcgagagaaag
ttcagggttaaactcctgggatttgatatcccagatctcccaagtaaggtaccatcactt
gtttacgtagaggcaacaataatctatggtaaaaagaccatatcttcaatttgctcaact
ccgaaagagtttacagatgaagttctgtggaacacctggctggagtttgacattttgatc
agggatatccctcaaggtgcaaaactaggtctcacaattaatgccacagaggcagctaag
gaaacaaagtcaagctcctctaaggtaccagatcaccataagggaaaattgcaggtacta
tacttcgtaaatctccaattgattgatcacagatcgcttcttagccaaggtccacacact
ctgaacatgtggcctttcccagaatgggatgaggaggcagtcacttatgaagcagacaag
ctgtctactgccaccaaccctgatgtagccaactcaatggcgattaccttcatgctggat
cgctacagctttcctgttgtcttgcctaatggcaggagctcctcttgtagtggtacatct
cctgtttcagagtcttcttcactggaccttgcaggggaatccagactctccgccccattc
agtgaggcttcttcaacagcaaccttaacaagaatgaggaacctaaaaaagttcaaagaa
gaaagtgtccactatgtctcaaatttacctcagtttcttcgcacagtcaactggatgctt
ccaactgtggtccaggaggtgcactggcttttgagtcactgggggccagaggacattgag
ctttttgtggcccttgagcttctgagtgtggattttgcggacctgaaggtcagaagattg
gcagttcaaagattagagattttatccaatgacgaggtgcttaagtatctgcttcagctg
gttcagacccttaaagtcgagccatatcacgatagctttctggcaagattcctgctaaaa
agagcactaaggagtaaacgcattggacacttcttcttttggtatttgcgaagtgaggtg
gcaggatgcccgtttttccgccagcgtatggcagtgatactggaggcatacctattgggc
tgtggagaggcaatgttggctgaattccagagtcaagtgcaagttgtcagttacctgcat
gacgttgctcttgcagtaaagttgctctacccagataggacagatcttccatcaacagct
cctcagaagctgcaggagttactggagaagtgtgatttaccctctgacttccaggtgcct
tttgatccccgtgtcagagcaggaagtatcatactaaaagactgtaagataatggcatca
aagaaaaagccactctggctggagttctcctgcattcagtcagaagctccaccctctcct
ccagtcggcatcatctttaaacatggagatgacctccgacaggacatgctcatcattcag
actctcgtggttatggactccatttggcaagaaaaaggtttagacttgaatctggtgccc
tatggatgcatttcaactggatttaacataggaatgattgaaattgtgcgaaatgcaatc
actattgcctcagttcagaggagtcagggtggagtggcgggagcttttaaaaacaatgcc
ctgtatgactggcttcagacgaagtgcccattccaggaaaaacactttcaagctacagag
aagtttgtgaactcatgtgccgggtactgtgttgccacgtatgtgctgggcattggtgac
cgtcacaatgacaacatcatgatcacagatcaaggaaacttgttccacattgattttggg
cacatcttgggaaacactaagagcttttggggagtgaacagagaaagggtgccatttgtc
ctcacccctgatttcctgtatgttatgggcagggtgaaaggccgtcccagtctctacttc
cagagatttagggacacatgcataaatgcctatctgtccctccgagctcagtctcggctt
cttgtgacgctcttctctctaatgctcctgaccggaatccctgagctcagcatgtctcaa
gacatgctttacctgcggacggcactgcaacaagatcagagcgaggaggaggcaagaaat
catctcctgcagcagattgcactttgtgaacacaaaggttggactgtgcaagctaactgg
tggtttcatttgatggctggcattaaatag

DBGET integrated database retrieval system