KEGG   Danio rerio (zebrafish): 564295Help
Entry
564295            CDS       T01004                                 

Gene name
traf2a
Definition
Tnf receptor-associated factor 2a
Orthology
K03173  
TNF receptor-associated factor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    564295 (traf2a)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    564295 (traf2a)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    564295 (traf2a)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    564295 (traf2a)
  Endocrine system
   04920 Adipocytokine signaling pathway
    564295 (traf2a)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    564295 (traf2a)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     564295 (traf2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
5
AA seq 575 aa AA seqDB search
MAAQEPSPPSSLEGNKPGFPKKILANKLEDKHLCNICLKILRRPFQAQCGHRFCSYCFNK
AVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKE
YEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMTVEKEKIHDHEQACS
YEHLNLLLHFIMGIKVNLESLQPQSLELASHKIHELHQSLRELELKMGQLCGAGASVQGA
CALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIV
CVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMS
AATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTH
LSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIA
SGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLTGL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacaggaaccctcaccaccatcttcattagaaggcaacaaacctggctttccc
aagaaaatactcgccaacaagctggaggacaagcatctgtgcaatatctgcctgaaaatc
cttaggagaccgtttcaggcgcagtgcggacatcgtttctgttcgtattgttttaataaa
gcagtgagctccggaccacagaaatgcagtgcctgcataaaagaggacatatttgaagag
ccaacatcaattttgaaacagggctgtgcttttcctgataatgctgctaagagagaagtt
gaagctcttgaagctgtttgtatcaatgaggagtgcagctggacaggcaccatcaaagaa
tacgaggcaaaccatgagggtaaatgtgacttcaggatcctgccctgcccatcatgcaaa
gagcttttaagagccaatgaacttgaacgtcacaatgagagagaatgcccagagcggacc
ctaaattgtaaatactgcaaggagccttttcattttaaaaacattaaggcccatgatgag
atctgccctaaatacccaatgatttgtgaaggctgtgccaagaaaaaaattcccagagag
aaatatgtggaccacattaaactgtgcaccaaattcagaacaccctgcagatttcatgtt
gtcggctgtgatatgacggtggagaaggagaagatccacgatcacgaacaagcctgttcc
tacgagcacttaaacctcctcctgcacttcatcatgggcatcaaggtgaacttggagagt
ctgcagcctcagagtctggagctggccagccataagatccacgagctgcatcagtctctg
cgggagctggagctcaagatgggccagctgtgtggagcaggggcttccgtgcagggggcc
tgtgcactgccgccgccaccaccgccagctccgacgctgggtacgtctttcaccccttta
cctactgccgtcggtgcagctttggagttgcagctgcacagtgagaaaaccaaagtggtg
gagctcagccgtcgctgtcaggagctggagctgaaagttaatacctttgagaacatcgtc
tgcgtgcttaaccgtgagatggagcgctccgctactaccatggaggcgtataatcgtcaa
catcggcttgaccaggacaagattgagatactcaacaacaaggtacggcagttggagagg
acggtaggccttagggatctctccatcgtggagatggaggctaagatgagggagatgtct
gctgccacctatgatggtgtgtttgtatggaagatctcagacttctcgaagaagagacag
gatgctgtagctggacgagcacctgctatgttctcacctgcattttacacaagcaaatac
ggctataagatgtgtttgcgcatctacctgaatggagatgggacaggacgtggcactcat
ttgtctctgttcttcgtggtgatgaggggacacagtgatgccttgctcaagtggcctttc
aatcagaaggtcaccctcatgttgctggatcagaacaacagggagcacatcattgatgcc
ttccggccagacatttcctcttcctccttccagaggcctgtgagtgacatgaacattgcg
agcggctgccccctcttctgcccgctctccaaactagactccaagaactcctacatccgg
gatgacaccatcttcatcaaggccatcgttgacctcacaggcctttaa

DBGET integrated database retrieval system