KEGG   Danio rerio (zebrafish): 564295Help
Entry
564295            CDS       T01004                                 

Gene name
traf2a
Definition
Tnf receptor-associated factor 2a
Orthology
K03173  
TNF receptor-associated factor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dre04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:dre04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:dre04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
5
AA seq 575 aa AA seqDB search
MAAQEPSPPSSLEGNKPGFPKKILANKLEDKHLCNICLKILRRPFQAQCGHRFCSYCFNK
AVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKE
YEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDE
ICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRTPCRFHVVGCDMTVEKEKIHDHEQACS
YEHLNLLLHFIMGIKVNLESLQPQSLELASHKIHELHQSLRELELKMGQLCGAGASVQGA
CALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIV
CVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMS
AATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTH
LSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIA
SGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDLTGL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacaggaaccctcaccaccatcttcattagaaggcaacaaacctggctttccc
aagaaaatactcgccaacaagctggaggacaagcatctgtgcaatatctgcctgaaaatc
cttaggagaccgtttcaggcgcagtgcggacatcgtttctgttcgtattgttttaataaa
gcagtgagctccggaccacagaaatgcagtgcctgcataaaagaggacatatttgaagag
ccaacatcaattttgaaacagggctgtgcttttcctgataatgctgctaagagagaagtt
gaagctcttgaagctgtttgtatcaatgaggagtgcagctggacaggcaccatcaaagaa
tacgaggcaaaccatgagggtaaatgtgacttcaggatcctgccctgcccatcatgcaaa
gagcttttaagagccaatgaacttgaacgtcacaatgagagagaatgcccagagcggacc
ctaaattgtaaatactgcaaggagccttttcattttaaaaacattaaggcccatgatgag
atctgccctaaatacccaatgatttgtgaaggctgtgccaagaaaaaaattcccagagag
aaatatgtggaccacattaaactgtgcaccaaattcagaacaccctgcagatttcatgtt
gtcggctgtgatatgacggtggagaaggagaagatccacgatcacgaacaagcctgttcc
tacgagcacttaaacctcctcctgcacttcatcatgggcatcaaggtgaacttggagagt
ctgcagcctcagagtctggagctggccagccataagatccacgagctgcatcagtctctg
cgggagctggagctcaagatgggccagctgtgtggagcaggggcttccgtgcagggggcc
tgtgcactgccgccgccaccaccgccagctccgacgctgggtacgtctttcaccccttta
cctactgccgtcggtgcagctttggagttgcagctgcacagtgagaaaaccaaagtggtg
gagctcagccgtcgctgtcaggagctggagctgaaagttaatacctttgagaacatcgtc
tgcgtgcttaaccgtgagatggagcgctccgctactaccatggaggcgtataatcgtcaa
catcggcttgaccaggacaagattgagatactcaacaacaaggtacggcagttggagagg
acggtaggccttagggatctctccatcgtggagatggaggctaagatgagggagatgtct
gctgccacctatgatggtgtgtttgtatggaagatctcagacttctcgaagaagagacag
gatgctgtagctggacgagcacctgctatgttctcacctgcattttacacaagcaaatac
ggctataagatgtgtttgcgcatctacctgaatggagatgggacaggacgtggcactcat
ttgtctctgttcttcgtggtgatgaggggacacagtgatgccttgctcaagtggcctttc
aatcagaaggtcaccctcatgttgctggatcagaacaacagggagcacatcattgatgcc
ttccggccagacatttcctcttcctccttccagaggcctgtgagtgacatgaacattgcg
agcggctgccccctcttctgcccgctctccaaactagactccaagaactcctacatccgg
gatgacaccatcttcatcaaggccatcgttgacctcacaggcctttaa

DBGET integrated database retrieval system