KEGG   Danio rerio (zebrafish): 564337Help
Entry
564337            CDS       T01004                                 

Gene name
ppp3r1a, si:ch211-274c22.8
Definition
protein phosphatase 3, regulatory subunit B, alpha a
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    564337 (ppp3r1a)
   04310 Wnt signaling pathway
    564337 (ppp3r1a)
   04370 VEGF signaling pathway
    564337 (ppp3r1a)
   04020 Calcium signaling pathway
    564337 (ppp3r1a)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    564337 (ppp3r1a)
   04210 Apoptosis
    564337 (ppp3r1a)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     564337 (ppp3r1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
13
AA seq 175 aa AA seqDB search
MAHKYSTMGKPLCGMTSVRFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLV
QRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQV
LKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggctcataaatacagcaccatgggtaaacctctgtgtgggatgaccagcgtgagattc
gatgctgatgagattaaacggctgggaaagaggtttaagaaactcgacctggataattca
ggatctctgagcgtggaggagttcatgtccttgcccgagttgcagcagaatccgctggtg
cagagagtcatcgacatattcgacaccgacgggaacggagaggtggatttcaaagagttc
atcgaaggcgtctctcagttcagtgtgaagggagataaagagatgaaactgcgcttcgcc
tttaggatctacgacatggacaaagacggctatatttccaacggcgagctgttccaggtg
ctgaagatgatggtgggcaacaacctgaaggacacgcaactgcagcagatcgtggataaa
accatcatcaacgcagacaaagacggagacgggagaatatccttcgaggagttctgcgcc
gttgttggaggtctggatatacacaagaagatggttgtggacgtgtga

DBGET integrated database retrieval system