KEGG   Danio rerio (zebrafish): 564487Help
Entry
564487            CDS       T01004                                 

Gene name
usp31
Definition
ubiquitin specific peptidase 31
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     564487 (usp31)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   564487 (usp31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 1303 aa AA seqDB search
MSSKSSSKEKKSGFSKKLFRRGSVRSVGSFMSRVLKTLSTLSHFGSELHAPDGEKDDGGF
TSFKNEGKGSVASDESDCGGFLSRDKIPGVAGLKNHGNTCFMNAILQCLSNTELFAEYLA
LEQYRGDQTDDEKPKTNGVVGRKGAQDRGEVTEQLSGLVRALWTFEYTPQHSRDFKNAVS
RSAMQYRGNAQHDAQEFLLWLLDRVHEDLNHLVHPNIRGSVKPPTEEDDAALEGPSPPLS
AGSFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQGKYSHC
MRIGVAVPLNSTVSRLREAVSRETKIPPDQFVLTEMYYDGFHRSFCDDDDDLDIIQESDS
VFAFETPETFRLENIRSKRGSLLANLNQNNLKYGAESSRTPSFMQGAVNPASPNKNTGSE
KMILLICNRACTGHQGRRFGLPFVLYLERSVTWDVLQKEILEKMRHLTRPGVYVQIGPFS
LRVVGVVGITYLLPQEEQPLCHPTVERAYKSCGPGGPPHVKIVVEWDKETKEYLFGHTEE
EYIPDAESVYLHREQHHQPQACTLAQCFQLYTKEEQLAPDDAWRCPHCRQLQQGRIKLSL
WTLPDVLILHLKRFRQEGDRRVKMQNMVRFPLLGMDMAPHVVKRSQSSWSLPSHWSPWRR
PYGLGRNPDDYLYDLYAVCNHHGNMHGGHYTAYCKNSIDGQWYCFDDSEVQPVADEDVCQ
QTAYILFYQRRTTIPSWSANSSVAGSTSSSLCEHWVNRLPGSRPPSLASGASSRRTSLIS
LAESVEFPGDRSEDDALALTNTGSPALLRGFSTRPFVRSIQRQSLSSRSSVTSPLAFSEN
GMKPSWSLSTKLQMRSNSPSRLSLDSRSSPPLERIGEACDDKVSTSCFGGYSRHERQPSS
KAPLAMMEGNGSDDGNGKRILDEAYCRAPLQADKKSSKGEPVDNNNQINAVDQNSLGPLS
KEQKHKSSEKKTEGSGSKKSSTKTKGDQEKPSKKRQSTSSVTKSPSSQVSSSPQVKGTKT
TNLKEKSNSPKSTKGTPSGTPSRKKESSESPVSGGTKGKPSLTSTPQSSASPSPTSKKSS
SLAERNSVSGKKKLVERGSSKDLTHTSPLAEKSRVSATPVRTSQPRTAEGSRPERRTVRS
SSSSSSVTSLRSPSVSSRDLCRSSKSEEKGLSFFRSALRQKETRRSADLGKTTILSKKAA
ERTAKSSSQNKLNADEGEGSGNSSQQVSPEPRSNKSANNEKESSKNSTPSKRSLLPVGKS
KSSNSETSLLSPINGKRPLEKVASSRKLSSSMQTSARPTQTPQ
NT seq 3912 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaatcttccagcaaagagaagaagtccggcttcagcaagaagctgttccgc
cggggttcggtgcgctccgtgggcagttttatgagcagggtcctcaagaccctctcaaca
ctctctcacttcggctctgagctgcacgcgcccgatggagaaaaggacgacggcggattc
acatccttcaagaacgaaggaaagggctcagtcgcgtcggacgagagcgactgcgggggc
tttctgtccagggacaagatccccggcgtggccggtttgaaaaaccacggcaatacgtgt
ttcatgaacgctattctgcagtgcctgagcaacacagagctgttcgccgagtatttggcc
ctggaacagtaccgaggagatcagactgacgacgagaagcccaagaccaacggggtcgtg
ggcagaaagggcgctcaggaccggggagaggtgaccgaacagctgtccgggctggtccga
gccttgtggacatttgagtacacaccgcagcacagtcgagacttcaaaaatgctgtttct
aggagtgccatgcaatatcggggaaatgcacaacacgatgcccaggagtttcttctctgg
ttactggaccgcgtccatgaagacctcaaccatctggtacaccccaacatcagaggatct
gttaagccacccacagaggaagacgatgcagctttagagggaccttcccctcctctgtca
gccggctcatttgtccaggagctgtttcaagctcagtacagatcctcgctaacctgtcca
cactgtcagaaacagagcaacacttttgatccttttctgtgtatctccctcccgattcca
ttacctcacacacggcctctgtatgtgactgtggtttatcaaggcaagtactctcactgc
atgaggatcggtgtggccgtaccgctcaacagcactgtgtccagactgagagaggccgtg
tcacgcgagaccaagatcccacccgaccagtttgtcctgactgaaatgtattacgacggt
ttccaccgctccttttgtgacgatgacgacgatcttgatatcattcaagaaagtgactca
gtctttgcttttgaaacccctgagacttttagattagaaaacattcgctctaaaagaggg
agcctccttgcgaatctgaatcaaaataatttgaaatacggagcagagagcagccggacg
ccgtctttcatgcagggcgcagtgaatccagcatcgcccaacaaaaacactggatctgag
aaaatgattctgctgatctgtaacagagcctgcactggccatcaaggacggaggttcggc
cttccatttgtactatatctagagcgcagtgtgacgtgggacgtgttacagaaggagatc
ctggagaaaatgcgtcacctgacaaggccaggggtttacgttcagattggacccttcagt
ctgcgagttgtcggagtggttggaatcacctatctgctgccgcaagaggagcagcccctg
tgtcatccaactgtggaaagagcatataagtcctgtgggccaggaggacctcctcatgtt
aagattgtagtggagtgggacaaggagacaaaggaatatttgtttggacacactgaggaa
gagtacatccctgatgctgagagtgtgtatctgcacagagagcagcaccatcagccgcag
gcctgcaccctcgctcagtgcttccagctctacaccaaagaggagcagttggccccagat
gatgcctggcgttgcccacattgcaggcagctgcaacagggacggatcaaactcagcctg
tggaccctgccggatgttctcatactgcacctcaagaggtttagacaggaaggagatagg
agggttaagatgcagaacatggtgagatttcctttgcttggtatggatatggcaccacac
gtggtgaaaagaagccagagcagctggagcttgccttcccactggtcaccttggagaagg
ccttacggactcggacgtaacccagacgactacctgtatgatctctatgctgtgtgtaac
catcatggcaatatgcatggaggacattacacagcgtactgtaagaattccattgatggc
cagtggtattgcttcgatgacagtgaggtgcagcctgtagcagatgaagacgtctgtcag
cagaccgcatacattctgttctatcaaaggaggacaactattccctcatggtcggcaaac
agctctgttgcaggttccaccagttcatctttatgtgaacactgggttaaccgactgcca
ggcagcaggccacctagtttggcgtccggagcctcctcaagacgtacatccctgatctct
ctggcagagtcggtggagtttcccggtgaccgcagtgaagacgatgctttagcgcttact
aacacaggatctcccgccttgctcagaggattttcaacaaggcccttcgtgagaagcatt
cagcggcagagcttgtcctccagatcatctgttacaagcccactggctttcagcgaaaat
gggatgaaaccttcctggtctctgtccactaaactccaaatgagatccaactcaccctcg
cgattgtctttggactctcgctcttcacctcctctagagaggataggagaagcttgtgat
gataaagtgtccacgtcttgctttggcggctacagcagacatgagcgtcagcctagcagt
aaagccccgttggccatgatggagggtaacggtagtgacgatggtaatggcaaacgaatc
ctagacgaggcttactgccgagctccactacaggctgacaagaaaagttcaaaaggtgag
ccggttgacaacaataaccagatcaatgctgtggaccagaactctctcggaccgctctcc
aaagaacagaaacataagagctcagaaaagaaaactgaagggtctggcagcaaaaagagc
tctactaagaccaagggggaccaagaaaagccctccaaaaagcggcagagcacctcctct
gttacaaaatctccatcctcccaagtgtcttccagccctcaagtgaagggcaccaaaacg
accaatctaaaagaaaagagcaattctcccaaaagtaccaagggtacaccttcaggaact
ccctccagaaagaaagagtcttctgagtctccagtgtcaggaggcacaaagggaaaaccg
tcccttacttccacaccccagtcctctgcctctccctcacctacatccaagaagagttcc
tcgctggctgagaggaactctgtttctggcaagaagaagctggtagagagaggctccagc
aaggatttgacacacaccagtccccttgcggagaagtctagagtcagtgccaccccagta
cggacatcccagcctaggactgctgagggaagccgtcccgaaaggaggactgtgagaagc
tccagtagtagttcctcagtcaccagcctgcgttccccaagtgtctcctcgagagacctg
tgccgcagcagtaaatctgaggaaaagggactctcattttttagaagtgcgcttcggcaa
aaagaaaccagacggtcagccgatctgggaaagaccacaattctatccaagaaagctgcc
gagaggacagcaaagtccagcagccaaaacaaactcaatgccgatgagggcgaaggctct
ggaaactcttcccagcaagtctctccggagcctcgctccaacaagtctgccaacaatgag
aaagagtcctcgaagaactccactcctagcaaacgctcactcttaccagtaggcaagtcc
aagtcttccaattctgagactagtcttctgtctcccatcaatgggaagaggcctcttgaa
aaggtggcatcctctagaaagctttcttccagcatgcaaacctctgcacggccaacacag
acgcctcaatga

DBGET integrated database retrieval system