KEGG   Danio rerio (zebrafish): 564519Help
Entry
564519            CDS       T01004                                 

Gene name
ncoa3, sb:eu248, sb:eu484, src3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     564519 (ncoa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 1497 aa AA seqDB search
MSGVGENSLEPLCSDRKRKLSTCDTPGQGCDKRRREQESKYIEELAELISANLSDIDSFN
VKPDKCAILKETVRQIRQIKEQGKSSCGDDDVQKADVSSTGQGVIDKDHLGPLLLQALDG
FLFVVSREGSIVFVSDNVTQYLQYKQEELINTSIYNILHEEDREELHKNLPKSNGPNSVS
WGGDSSRQKSHTFNCRMLVKFGHGGPGGEEGAGGPRYETMQCFALTQPKAMMEEGEDLQS
CMICVARRVTAVERTERFSTRHELSGKLIEIEQQSLLHTTMRPGWEDLVRRCMQMFLHRS
EGQPWSYKRHYHEAYVHGRAETPPYRFSLSDGTPVTAQTRSELCRNPVTSDPHTFLSTHL
LQREQNGYRPNQGGVMRSVMGNANPNAQMGMGNTRGYGMNEQGHMGPRGGAMYGPGNRMN
QMNPMHQMNQMNQMNSMNQMNMNQMNCMNQMGSMNQMNQMNQMNSMNQMGHPGMNQHQQG
QFHGGGGYGMVMTSPSQGSPGMNPGQQNLMGSPRIRGSPKMGASPFSPGGMHSPMGPVGM
GGSSGSSGPSVGNTFSSSSLNALQAISEGVGSSLPSALNSPAHKSDSSPNINSTQSSQQG
PIGNNKPITSDSKSPSSAHSTGLDQQQASSTENTDKPDSQSNKDGSAGGEVNRRVPDGKG
HKKLLQLLTSPTEEIGIGTATSGPVPGRASTPMGSDPKETGSGMMSPSSTGVSSSSGSSS
GNNVNQQSSGGVSSTACPSGHHSTHTLQEKHKILHKLLQNGNTPDDVARITAEATGKSSL
SSEHPGAEGRNLELKQEQHSPKEGKKPQALLHYLLNKDDSKEPGATEVKPKLEELEARGA
SGGQGAGVTTSSSSNQESKVKLEQPDELESLESILGGLRNPGPGMFVDSGSGGSEVGNKQ
GNGPNSTAHDREGVGMGSGQRVPFQRAVSVDGKPMSGPGMTGRKSAPSSLVKQEHTDSQI
GMGGPNRLMGMPNRPPMAGAGDWMSSSGSPAGSVGHPGMGRPGMDHNPKSMMGGPMVSRS
NSVPATRSMLQQQLMEMGPYDVGMGMNSFRGQAPPPQSPSWPDSGMGMEGPPSANRLPIN
SPLDELLAPPSTSEGQSDERALLDQLDSLLNNTDVIALEEIDRALGIPDLINQGHSSDQP
PPSDPFSGPCLGPDSSMGMEPPKAMYGQGYPGPPSMGMQGGYGPGPNPGAGPGPGPMQGQ
SGPGFNPMMSQMNQQGGFPGMGGMGPMHPRANMMRNRVPQAKPLRLQLQQRLQGQQFLNQ
SRQAMGMRPDASPAGNPGMRPSMQPGMGGQPGFLNAQMMAQRSREMLNLQTEMRRQRMMM
MMQQQQQQQQQVAAGGFSPPPNVTAPTGMDNPMAGPPMSQPGQQAFNYGGNYGIGQQGDP
SFVGTGSSPPNNMMSGRMGGPQNPMMQQHPQSNPMYQSAEMKGWGQGPMPMNNSYPQQQQ
YPQQGAPGQYGGMMMNGSMQGGVNGNGAGQMPPMQGQMGMNTMGMGRMPMGPDQKYC
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagtgggtgagaactcacttgagccgttgtgctcggacaggaagcgcaaactc
tccacatgtgacacaccaggacaaggatgtgataagcgcaggagggaacaggagagcaag
tatatcgaggaactggctgagctgatttcagccaaccttagtgacatcgacagcttcaat
gtcaaaccagacaaatgtgccatccttaaagagacagtgcgccagatacgccagatcaaa
gagcaaggtaaaagctcatgtggtgatgatgatgtccagaaggcggatgtgtcctccact
ggtcaaggggtcatcgacaaggaccatctgggccctctgttgctgcaggcgttggatggg
tttttgtttgtggtgagccgtgaaggcagcattgtgtttgtgtcggataatgtgactcag
tacctgcagtataaacaggaggagctgatcaacaccagcatctacaacatcctgcatgaa
gaagaccgggaagaactgcataaaaacctgcccaaaagcaatggccccaacagtgtgtca
tggggaggtgattcgtcccgtcagaagagccacacgtttaactgccgtatgctggtaaag
tttggacatggtggtcctggaggtgaagaaggggctggtgggccacgctatgagaccatg
cagtgttttgctctcacacagcctaaagcaatgatggaggaaggagaagacctgcagtca
tgtatgatttgtgtagcacggagagtgaccgcagtggagaggacagaacgattcagcacc
agacatgaattatcaggtaaactgattgagatcgagcagcagagtcttctgcataccacc
atgcgtcctggctgggaggatttagtgcgccgctgtatgcagatgttcctgcatcgcagt
gagggtcagccctggtcatacaagagacattatcatgaagcatatgttcatggtagagca
gaaactccgccctatcgcttctccttatcggatggcactccggtgactgcacaaacgcgc
agtgagctctgtcgaaatccagtcaccagtgacccacacaccttcctctctactcatctt
ctgcagagggagcaaaacggatacagacccaaccagggtggtgtaatgcgatcagttatg
ggtaatgccaatccgaatgctcagatgggcatgggcaacactaggggctacggcatgaat
gagcaaggccacatgggacccagaggcggagcaatgtatggcccgggaaacaggatgaat
cagatgaacccgatgcaccagatgaatcaaatgaaccagatgaattcgatgaatcaaatg
aatatgaatcagatgaattgcatgaatcaaatgggctcaatgaatcagatgaatcaaatg
aatcaaatgaactctatgaatcagatgggccatcctgggatgaatcagcaccagcagggc
cagtttcatggtggtggcggctatggaatggtaatgacaagtccctctcaaggaagtccg
ggaatgaatcctggtcagcagaatctcatggggtctccgcggatacgagggagtcctaaa
atgggagcaagtccattttcacctggaggtatgcactctcccatgggtcccgtaggcatg
ggtggcagtagtggatcttcaggtccatcggttgggaataccttctctagcagctcattg
aatgccctccaggccatcagtgaaggtgtgggttcttctctaccttcagctctcaactca
cctgcccacaaatccgacagttctcccaatatcaactccactcaatccagtcagcaaggc
ccgatcggcaacaacaaacccattaccagtgactccaagagtccatcaagtgctcacagc
acagggttagaccagcaacaggcctcttctacggagaacacagacaaaccagacagccag
tccaacaaggatggatccgctgggggagaagtcaaccggagagtccctgatggaaaaggc
cacaagaagctacttcagttgctcacatctccaactgaagagattggcatcgggactgcg
actagtggacctgttccaggtcgtgcgtccactccgatgggatctgacccgaaggagact
ggaagtggcatgatgagtccttcctccacaggggtgtcctcttcatccggttcatcatcc
gggaataacgttaatcagcaaagctcgggtggagtgtcgtccactgcttgtcctagtgga
catcacagcactcacaccttacaggagaaacacaagatactccacaagcttcttcagaat
ggaaacacacccgatgacgtggctcgcattacagctgaagccaccggcaagtcctcgctt
agttcagaacacccgggtgctgaggggaggaatctggagctcaaacaggagcagcacagt
ccgaaagaaggaaaaaagccacaagccctccttcactacctcctcaataaggatgactcc
aaagagcccggtgctacagaggtcaagccaaagctggaggagcttgaagcaagaggggca
tctggagggcagggggcaggggtcacgacctccagttctagtaaccaggagagcaaggtc
aagctcgaacaaccggatgagctggaaagtttagagagtatcctcggtgggctgaggaat
cccggtcctggaatgtttgttgattctggatctggagggtcagaagtgggcaataagcag
ggcaatggacctaacagcaccgcccacgaccgagagggtgttggtatgggttctggtcaa
cgtgtgcccttccagagggcagtgtctgtcgatggaaaacctatgagtgggccaggcatg
actggtagaaagagcgcaccatcctctcttgtcaaacaggagcatactgatagccagatt
ggcatgggaggtccaaacaggctcatgggaatgcccaatcgacctccaatggcaggtgca
ggagattggatgtccagttctggcagtcctgctggttccgtcggacaccctggcatgggt
cgcccaggcatggaccacaatcccaagagcatgatgggaggtcccatggttagccgatct
aacagcgttcctgcaaccagatccatgttacaacagcagttgatggaaatggggccgtat
gatgtaggaatgggtatgaattcgttcagagggcaggctcctccaccacagtccccttcg
tggccagatagtgggatgggaatggagggaccaccgagtgcaaacaggctgccgataaat
agccctcttgatgaacttctggctcctccatccacctctgagggtcagagtgatgagcga
gctctgctggaccagctggactctttgctcaacaacactgacgtcatcgctctggaggag
atcgaccgtgcccttggcataccagatctcatcaaccagggtcatagttcagatcagcct
cctccatcggaccctttctctggtccttgtctgggtccagactcctctatgggtatggaa
cctcccaaggcgatgtatggacagggctacccgggacccccttccatggggatgcagggc
ggatatggtcccggtcccaaccctggtgctggtcctggacccggtcccatgcaagggcag
tcaggaccagggtttaatcccatgatgagccagatgaaccagcagggtggcttccctggg
atgggtggtatgggcccaatgcatcctcgtgcaaacatgatgaggaaccgagtgcctcag
gccaaacctctcagattgcagctccagcagagactgcagggacagcagtttttgaaccag
agccgacaggccatgggcatgagacctgatgccagccctgcaggaaaccctggcatgaga
cccagcatgcagccaggcatgggcggacagcctggtttcctgaatgctcagatgatggca
cagcgcagcagagaaatgttgaatcttcagacagagatgagaagacagaggatgatgatg
atgatgcagcagcagcagcagcaacagcagcaggtggctgcaggaggtttcagtccccct
cctaatgtcacagcgcccacaggaatggacaaccccatggcaggaccaccaatgagccag
cccggacagcaggcctttaactatggaggcaactatggtattggccagcagggggaccct
tcatttgtgggaacaggtagcagcccccctaacaatatgatgtctgggcgaatgggtggc
cctcagaatcccatgatgcaacagcaccctcagagcaaccccatgtaccaatcggcagaa
atgaagggctggggacaggggcccatgcctatgaataattcatacccccagcaacagcaa
tatccccagcagggggcgccaggacagtatggtggaatgatgatgaacggctccatgcag
gggggtgtgaatggcaacggtgcaggacagatgcccccaatgcagggccagatgggcatg
aacaccatgggcatgggacgcatgccaatgggacctgatcagaagtactgctga

DBGET integrated database retrieval system