KEGG   Danio rerio (zebrafish): 564632Help
Entry
564632            CDS       T01004                                 

Gene name
usp10, id:ibd1190, wu:fc19h08, wu:fc76g05, wu:fi11g01
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     564632 (usp10)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   564632 (usp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
7
AA seq 864 aa AA seqDB search
MASQSNQYIFGEFSPDEFNQFFVTPRCYVELPPFNDKVTCVSHSSGGYCTPAVPYITESL
RRQVCGEDYQHIEFGVDEVMNAEPVAVKDSLYKVSSTLNPQAPEFILGCQPSQKSLATAT
PVADIPDGAEFNSLCCSNSETSDMGSHQACLDMDGVSGGLGQRKKKKKRPPGYYNYLEGS
NSNSTGVATDGVGPPSLVNGHSPNAPLLSSEDLVGDILPGAELIPPNSITSAPQTTPLSN
QRTCESPDNTFDLTSGAASLLDRNGAASLSTSSSSSQSSGVAQSARTAEQHAEPPALESP
VLLDNGGHSSSPPSPLPCAALATPTTTIPATTDEREAEGLGEANGLPETASAAGAVDELQ
DSSETSEVQSASSLTPLSLDSDVQPVVSPVVPAAPAITPPKSWASLFHNSKPLPGGPQAY
VEVKSVPAVVTFTPTASELPEKVSEVREGPVPVSEDPMAPKLAELIENVKLIHKPVSLQP
RGLINKGNWCYINATLQALIACPPMYHLMKSIPLFSETQRPCTSTPMMDNFIRLVNEFSN
MPVPSKAKQQAAGEKILKDLRVGAPFEPTYVYKLLTLIKSSLSEKGRQEDAEEYLGFILN
GLHEEMLALKKLISPQEETPTPNGPESQPGVEEDPAEKEEGSDDEWEQVGPRNKTSITRQ
ADFIRTPITDIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSEKIRTVQEALEVLVARE
SVQGYTTKSKQEIEISRRVTLEELPPVLVLHLKRFVFEKTGGCQKLIKTIDYPVDLEISK
DLLSPGVRGKTMKGQRTYRLFAVVYHHGNSATGGHYTTDVFHIGLNGWLRIDDQAVKIIN
QHQVVKQTAERTAYLLYYRRVDLM
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcaaagtaaccagtatatctttggggagttcagcccagacgagttcaatcag
ttctttgtgactccccgatgttatgttgagcttcccccgttcaatgataaagtcacctgc
gtcagccattcctcaggaggttactgcactcctgctgtgccttacataacggaatcattg
agacggcaggtttgcggagaggactaccagcatattgagtttggtgtggatgaggtaatg
aatgcagagcctgtggcagtgaaagactcgctgtacaaagtctctagcactcttaatcct
caggcccctgagttcatcctgggctgccaaccatctcagaagtcccttgccacagctaca
cctgttgctgatatcccggacggtgccgagttcaactccctatgctgcagcaactctgag
acctcagacatgggcagccatcaagcctgcttggacatggatggggtttcgggtggcttg
ggacaacggaagaaaaagaaaaaacgaccgccgggatactacaactatctagagggttca
aacagcaacagcactggtgtggccacagatggagtggggcccccaagcctggtcaacgga
cattcaccaaatgctccactcctgagttcagaggacttggttggggacattctacctggg
gcagagctaattcccccaaattctataacatctgcaccccaaaccaccccactttccaat
cagaggacttgtgaaagccctgacaatacatttgacttgacgagtggagctgcctctttg
ttagacagaaatggtgcagcttctttgtctacttcatcttcgtcctctcagagcagtggg
gtggcacagagtgccaggactgcagagcaacatgcagaaccccctgctttagagagccca
gtacttctggataacggcgggcacagctcctctccaccttcccctcttccctgtgctgct
ctggccacccctacaaccacaattcctgctactactgatgagagggaggccgagggcttg
ggggaggccaacgggctgccagagaccgcctcagctgctggagctgtggatgaactccag
gactcctctgaaacgagtgaggtgcagtctgcttcctctctaacccctctctcgttagac
tctgacgttcagccggtggtctcgcctgttgtcccggcagcacctgcgatcaccccaccg
aaatcctgggcaagcctcttccacaactccaagcctctacctggaggtcctcaggcgtat
gttgaggtgaagagtgtgcctgctgttgtcacattcacaccgactgcctccgagttgcct
gaaaaggtcagtgaggtgcgtgaaggccctgtccccgtgtctgaagaccctatggcccca
aaattggcagagttaatagagaatgtgaagttgatacacaaacctgtgtctttgcaacca
agaggactgataaacaagggaaactggtgctatatcaatgctaccctgcaggctctgatt
gcgtgtccccctatgtatcatctgatgaagtctatcccccttttcagcgagactcagaga
ccctgcacatccacccccatgatggataactttattcggcttgtgaatgagttcagcaat
atgcctgtcccttcaaaggctaaacagcaagctgctggagagaagattttgaaagacctt
cgagtgggagctccttttgaacccacatacgtctataaactcctcaccctcatcaaatca
agcctatcggagaagggtcgccaggaagatgcggaggagtaccttggtttcattttaaac
ggactgcacgaggaaatgctggcactgaagaagctgatctctccacaggaagagaccccc
acaccaaatgggcccgagtctcagcctggtgtggaggaagaccctgctgagaaggaagaa
ggcagtgacgatgagtgggaacaggttgggcccagaaacaaaacctccatcacccggcag
gcagatttcattcgcactcccattaccgacatattcggtggccatatcagatctgtggtg
taccagcagagctcaaaagagtcggccaccttgcagccgttcttcacgctgcagctggac
atccagtctgagaagatccgcacagtccaggaggctctggaggtactggtggcgcgggag
tccgttcagggctacaccaccaagagcaagcaagagattgagatcagccgaagagtgacc
cttgaagagcttcctccagtgctggtgcttcacctcaagagatttgtcttcgagaagact
ggtggatgtcagaaactgatcaagaccattgattaccccgttgatctggagatcagcaaa
gatctcttgtcaccgggtgtgagaggcaaaactatgaaaggccaaagaacctacaggctc
tttgcagtcgtctatcaccatgggaacagtgccacgggtggccactacactacagatgtc
ttccacatcggtctgaacggctggctgcgcattgatgaccaggcggtgaagatcatcaat
cagcatcaggtggtgaagcagactgcagagcgcactgcctacctgctgtactaccgccgc
gtggacctgatgtag

DBGET integrated database retrieval system