KEGG   Danio rerio (zebrafish): 564746Help
Entry
564746            CDS       T01004                                 

Gene name
glsb
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X2
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00220  Arginine biosynthesis
dre00250  Alanine, aspartate and glutamate metabolism
dre00471  D-Glutamine and D-glutamate metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    564746 (glsb)
   00220 Arginine biosynthesis
    564746 (glsb)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    564746 (glsb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     564746 (glsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 564746
NCBI-ProteinID: XP_005167956
ZFIN: ZDB-GENE-030616-550
Ensembl: ENSDARG00000040705
Vega: OTTDARG00000025986
Position
9
AA seq 633 aa AA seqDB search
MLQFRASIVLKELIQTSPKRLLSDIIRHKKTLPNAYCFSAANNGRISKLNIVHYGRCFIQ
PLAGRRFLCTKTEGAIEPTETAKKDETVQEAAADKKAGILPSLEDLLFYSIAEGQERIPA
HKFITALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFR
KKFVIPDFQSFASHIDTLYEKGRNLSGGLVADYIPQLAKFSPDLWAVSLCTVDGQRHTVG
DTKVPFCLQSCVKPLKYAISVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNA
GAIVCTSLIKQLAGNAEKFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLK
EKKCFPDGTDMTAVLDLYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRDT
LSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQ
FCTDLVSLFNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSS
VDMEQRDYDSRTALHVAAAEGHIEVVRFLLEACKVNPAPKDRWGNTPMDEAKHFGHQEVQ
ALLQEFNSKYNPTINPVADKETTEKNLDGMLET
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttacagtttagggcttcaattgtgctgaaggagttgattcaaaccagccctaagcgt
ttgttgtcggacattattaggcacaaaaagactttacctaacgcgtactgcttcagcgct
gctaataatggcagaatatctaaactaaacattgtccattatggaaggtgtttcattcag
cctttagctgggagaagattcctatgtacaaagaccgagggagcgattgaacccactgag
acagcgaagaaagatgagaccgtccaggaagcggcggcagataagaaggctggcattttg
cccagcttggaggacctgctgttttacagtattgctgaaggccaggagaggatcccagct
cacaaattcattacagcactgaaggccactggacttcgcactggagatccacggcttaaa
gaatgtatggacatgttaaaagtcaccctgaaatctacatcagatggagtaatgctggac
agacacctgttcaaaaagtgtgtccagagcaacattgttctgctaacgcaggctttccgg
aagaagtttgtcatccctgatttccagtcttttgcctctcacattgatacactttacgag
aaaggccgaaatctttctggagggctggttgctgactacattccccaacttgccaaattc
agcccagatctgtgggccgtttccctttgcacagtagatggacaaagacacacagttggt
gacactaaagtgccattctgcctgcagtcgtgcgtgaagccgctgaagtacgctatatcc
gtgcacgaccacggcactgaatatgtgcaccgtttcattgggaaagagcccagtggctta
cgcttcaacaagctcttcctagatgaggacgataaaccacacaatccaatggtgaatgct
ggggcgatcgtatgtacttctcttataaagcaattagcaggcaatgctgagaagtttgat
tatgtcatgaactttttgaagaagatggcaggaaatgaatatgtcggtttcagcaatgcc
acattccagtcagagcgtgagtcaggagacaggaatttcgctattggctactacctgaaa
gaaaagaagtgttttccagatggtacagacatgacggctgttctggacttgtactttcag
ctgtgctccatcgaggttacgtgtgagagtgccagtgtcatggctgccacgttggccaat
ggtggcttctgtccaatcacaggcgagcgtgtgctgagtcctgaagctgtgcgagacacc
ctcagcctcatgcactcctgtggcatgtatgacttctcaggacaattcgccttccatgtt
ggtcttccggccaagtcaggtgtgtctggaggtattctgctggttgtacccaatgtgatg
ggcatcatgtgctggtctcctccgctggacaaacttggcaacagtgtgcggggcatccaa
ttctgcacggatctggtgtccttgtttaacttccacaactacgacaacctgcggcacttc
gccaagaagctggaccctcggcgggaaggcggagaccagcgggtgaagtctgtcatcaac
ctgctgtttgctgcttacaccggcgatgtttctgctctgaggaggtttgctctgtcctcg
gtggatatggagcagcgtgattatgactccaggacagctctgcacgtcgcagccgctgag
ggacacatcgaggttgtgcgttttctgctcgaggcctgcaaggtcaatcctgcacccaaa
gacaggtggggcaacacaccaatggatgaggcgaaacattttggtcatcaggaggtgcag
gcgctcctgcaggagttcaacagtaagtacaaccctaccatcaatcctgtggcagataaa
gagaccactgagaaaaacctggacgggatgctggagacgtaa

DBGET integrated database retrieval system