KEGG   Danio rerio (zebrafish): 564746Help
Entry
564746            CDS       T01004                                 

Gene name
glsb, gls, si:dz87i4.2, wu:fa97e05
Definition
glutaminase b
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dre00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dre00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:dre00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 633 aa AA seqDB search
MLQFRASIVLKELIQTSPKRLLSDIIRHKKTLPNAYCFSAANNGRISKLNIVHYGRCFIQ
PLAGRRFLCTKTEGAIEPTETAKKDETVQEAAADKKAGILPSLEDLLFYSIAEGQERIPA
HKFITALKATGLRTGDPRLKECMDMLKVTLKSTSDGVMLDRHLFKKCVQSNIVLLTQAFR
KKFVIPDFQSFASHIDTLYEKGRNLSGGLVADYIPQLAKFSPDLWAVSLCTVDGQRHTVG
DTKVPFCLQSCVKPLKYAISVHDHGTEYVHRFIGKEPSGLRFNKLFLDEDDKPHNPMVNA
GAIVCTSLIKQLAGNAEKFDYVMNFLKKMAGNEYVGFSNATFQSERESGDRNFAIGYYLK
EKKCFPDGTDMTAVLDLYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRDT
LSLMHSCGMYDFSGQFAFHVGLPAKSGVSGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQ
FCTDLVSLFNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSS
VDMEQRDYDSRTALHVAAAEGHIEVVRFLLEACKVNPAPKDRWGNTPMDEAKHFGHQEVQ
ALLQEFNSKYNPTINPVADKETTEKNLDGMLET
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgttacagtttagggcttcaattgtgctgaaggagttgattcaaaccagccctaagcgt
ttgttgtcggacattattaggcacaaaaagactttacctaacgcgtactgcttcagcgct
gctaataatggcagaatatctaaactaaacattgtccattatggaaggtgtttcattcag
cctttagctgggagaagattcctatgtacaaagaccgagggagcgattgaacccactgag
acagcgaagaaagatgagaccgtccaggaagcggcggcagataagaaggctggcattttg
cccagcttggaggacctgctgttttacagtattgctgaaggccaggagaggatcccagct
cacaaattcattacagcactgaaggccactggacttcgcactggagatccacggcttaaa
gaatgtatggacatgttaaaagtcaccctgaaatctacatcagatggagtaatgctggac
agacacctgttcaaaaagtgtgtccagagcaacattgttctgctaacgcaggctttccgg
aagaagtttgtcatccctgatttccagtcttttgcctctcacattgatacactttacgag
aaaggccgaaatctttctggagggctggttgctgactacattccccaacttgccaaattc
agcccagatctgtgggccgtttccctttgcacagtagatggacaaagacacacagttggt
gacactaaagtgccattctgcctgcagtcgtgcgtgaagccgctgaagtacgctatatcc
gtgcacgaccacggcactgaatatgtgcaccgtttcattgggaaagagcccagtggctta
cgcttcaacaagctcttcctagatgaggacgataaaccacacaatccaatggtgaatgct
ggggcgatcgtatgtacttctcttataaagcaattagcaggcaatgctgagaagtttgat
tatgtcatgaactttttgaagaagatggcaggaaatgaatatgtcggtttcagcaatgcc
acattccagtcagagcgtgagtcaggagacaggaatttcgctattggctactacctgaaa
gaaaagaagtgttttccagatggtacagacatgacggctgttctggacttgtactttcag
ctgtgctccatcgaggttacgtgtgagagtgccagtgtcatggctgccacgttggccaat
ggtggcttctgtccaatcacaggcgagcgtgtgctgagtcctgaagctgtgcgagacacc
ctcagcctcatgcactcctgtggcatgtatgacttctcaggacaattcgccttccatgtt
ggtcttccggccaagtcaggtgtgtctggaggtattctgctggttgtacccaatgtgatg
ggcatcatgtgctggtctcctccgctggacaaacttggcaacagtgtgcggggcatccaa
ttctgcacggatctggtgtccttgtttaacttccacaactacgacaacctgcggcacttc
gccaagaagctggaccctcggcgggaaggcggagaccagcgggtgaagtctgtcatcaac
ctgctgtttgctgcttacaccggcgatgtttctgctctgaggaggtttgctctgtcctcg
gtggatatggagcagcgtgattatgactccaggacagctctgcacgtcgcagccgctgag
ggacacatcgaggttgtgcgttttctgctcgaggcctgcaaggtcaatcctgcacccaaa
gacaggtggggcaacacaccaatggatgaggcgaaacattttggtcatcaggaggtgcag
gcgctcctgcaggagttcaacagtaagtacaaccctaccatcaatcctgtggcagataaa
gagaccactgagaaaaacctggacgggatgctggagacgtaa

DBGET integrated database retrieval system