KEGG   Danio rerio (zebrafish): 564976Help
Entry
564976            CDS       T01004                                 

Gene name
dyrk4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     564976 (dyrk4)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   564976 (dyrk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 627 aa AA seqDB search
MGPRAESERGEGENREKSARPEAFPHPHRAQADNTKIGPNCTYTQKCGTGVGTLPQLEAP
VKQVLVTNGKLLHSNGTLPSIVKQLVQSTQGNQEERPRPQFPNRFGSSVENLSESLTRSI
INKFEKIRTYEGQRLPMSPTTALKHFQNQLTEYEREEIMDYSEIWYLGLDTKKIEGSQGS
PQNAGYDDEHGSYLKVLHDHIGYRYEVLEVIGKGSFGQVLKCLDHKTNETVAIKIIRNKK
RFHHQALVELKILDAVRRRDRDNCHNVIHMKEYFYFRNHLCISFELLGANLYELIKKNNF
QGFSLGLIRRFAHSLLKCLQMLHKEKIIHCDLKPENILLSQRGQGNIKVVDFGSSCYEQQ
RVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELYTGYPLFPGESEVEQIACIMEI
MGLPPNDFVQTASRRRLFFDSKGNPRNITNSKGKKRRPSSKDLASVLKTNDPLFLDFIQR
CLVWDPTKRMTPDEAMQHEWITEGRLNRLHPKPRPLRKESDNNYEFTYRKATGNRTADKS
GSDEKLKRVSDASSKGGKTVSEERLRPIGASAEEENSENSSKSLSKDSKTDSSGERSVQI
IIKPQTGSSSDSSSSEGPEPQFLPPIV
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgagggcagaatctgaaagaggtgaaggagaaaacagagagaagtcagccaga
cccgaggctttccctcacccacacagggctcaggccgacaacactaaaataggacccaac
tgcacctacacacagaagtgtgggacaggcgttggtactttgcctcaactagaggctcct
gtcaagcaagttttggtgaccaatggcaaacttctgcattcgaatggaaccttaccaagc
attgtcaaacagttggtgcaaagcactcaggggaatcaggaggagagaccaaggccgcag
tttcccaatcgctttggttcgtcggtggaaaacttgtctgaatccttaaccaggagcatt
attaataagtttgagaagatcagaacatatgaaggacagaggctgccaatgtctccaaca
acggcactgaaacacttccagaaccagttaacagaatatgagcgggaagagatcatggat
tactctgagatctggtatctgggtttggacacaaagaagattgaaggctcccagggatcc
ccacagaatgcaggctatgatgatgaacatggcagctacttaaaggtcctgcatgaccat
ataggctatcgctatgaagtgctggaggtgattgggaaaggatcgtttggccaagtcctg
aagtgtttggatcacaagacaaatgagacggtggccatcaaaatcattcgaaataagaag
aggtttcatcatcaggctctggtcgagctgaagatcctggatgctgtgcggagaagggac
agagataactgccacaatgttattcacatgaaggagtatttctacttccgcaaccacctg
tgcatctccttcgagctgctcggggcaaacctgtatgagctgatcaagaagaacaacttc
cagggcttcagtctgggtctgattcgccgcttcgctcattcactgctcaagtgcctccag
atgctgcacaaagagaagatcatccactgtgaccttaaaccggagaacatactgctttct
caaaggggacaaggaaacatcaaggtggtcgactttggatcgagctgttatgagcaacag
agagtgtacacttacatccagagccgcttctaccgctcaccagaggtgattctgggtcat
ccttacagcatggctatagacatgtggagtctgggttgtattttagctgagctttacacc
ggttatccactctttccaggggagagtgaagtggagcagatcgcctgtatcatggagatc
atgggacttcctccaaatgactttgtccagactgcatcgagacggaggttattttttgac
tcgaaaggaaatccaagaaatatcaccaacagcaaaggaaagaaacgtcgacccagctct
aaagatttggccagtgtgctgaagaccaacgatcctctctttcttgacttcattcaacgt
tgccttgtgtgggatcccacaaagcgcatgacgcccgatgaagcgatgcagcatgagtgg
atcacagagggacgtctcaacagactccatccaaaacctcgccctctacggaaagaaagt
gataacaattatgaatttacctaccgcaaagccacaggaaacaggacagctgataaatca
ggatctgacgagaagctaaagagggtcagtgacgcctcaagcaaaggaggaaagacggtc
tcagaagagcgcctgcgtcccataggagcctcagctgaggaagaaaacagtgagaattca
agcaaaagcctgagcaaagacagcaagacggactcgagtggcgagcgatccgttcagatc
atcatcaaacctcagacgggctccagctctgattcctcgtcctctgaaggcccagagcct
cagtttctgccccccattgtataa

DBGET integrated database retrieval system