KEGG   Danio rerio (zebrafish): 565370Help
Entry
565370            CDS       T01004                                 

Gene name
comtb, si:dkey-13a21.15, zK13A21.15, zgc:162236
Definition
catechol-O-methyltransferase b (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    565370 (comtb)
  Amino acid metabolism
   00350 Tyrosine metabolism
    565370 (comtb)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     565370 (comtb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   565370 (comtb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
11
AA seq 264 aa AA seqDB search
MLGVLLCWCLGASVLLYVLYSWLIPAAVQFNGSLALLWHDVIVERALDSLTRSTRPQRLL
KAVKQHATRGDPQSVISAIDHFCRHREWAMNVGDEKGCILDSVVSELNPEKVLELGTYCG
YSTVRIARLLPPGARLITLEFNPDYAVIARQVIAWAGIEDKVQLVEGASEDWIPRMKEHF
GIETFDLVFLDHWKDHYLPDTKLMEGCGLLRKGTVLLADNVICPGVPDYLEYVRNSRSYK
SCYFKSHLEYTRAEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgggggtgttgctgtgctggtgtttaggggcctcagtgctgttatacgtcctgtac
tcgtggctgattcctgcagcggtgcagtttaatggcagtctggcgttactctggcatgat
gtcatcgtggagcgagctttggattccctgacccgatcaactcgaccacagcgtctgctg
aaagctgtaaagcagcatgcgactcgaggcgaccctcagagcgtcatctctgccattgat
cacttctgcagacaccgcgaatgggctatgaatgttggagatgagaaaggctgtatcctg
gattcagtggtaagtgagctgaacccagagaaggtcctggagttgggcacatactgtggc
tactctacagttcgcatcgctcgtctgcttcctcctggagctcgtctcattacactggag
ttcaacccagattacgctgtgattgctcgacaagtcatcgcctgggctggaattgaagac
aaagtgcagcttgtagaaggtgcgtctgaagactggatcccacgcatgaaggagcacttt
ggaatcgaaacctttgatttagtttttctggaccactggaaagaccattaccttcctgac
actaaattaatggagggttgtggtctgctaaggaaaggcacggttcttcttgctgataat
gtgatctgtcctggagtcccagactatcttgaatatgtgcgcaatagccgttcctataaa
agctgctattttaaatcccatttagagtacaccagggcagaggatggcttggagaagtct
gtgtttttgggctag

DBGET integrated database retrieval system