KEGG   Danio rerio (zebrafish): 565372Help
Entry
565372            CDS       T01004                                 

Gene name
hexdc
Definition
(RefSeq) hexosaminidase D
  KO
K14459  hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00511  Other glycan degradation
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    565372 (hexdc)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     565372 (hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20
Motif
Other DBs
NCBI-GeneID: 565372
NCBI-ProteinID: NP_001070635
ZFIN: ZDB-GENE-060929-448
Ensembl: ENSDARG00000061216
Vega: OTTDARG00000027510
UniProt: F1R118
Position
12
AA seq 480 aa AA seqDB search
MDLSLRTCKKFVHLDLKGAPPRIGYFIELIQLFADLGANGLLIEYEDMFPYEGELQVLQS
KSQPPYSREEIASIQDAASSRGLEIIPLVQTFGHLEFVLKHKVFRDLREVDCCLGTLNPN
CDRGVKLVQEMLKQVMKLHPNSTSLHIGADEVYMLGLGDESKQWLTAPGRNVHQLFLGHV
LKVAKSIQESLPNLKLIMWDDMLRSMTSETIKESGLVGLVQPMLWDYSPTLDVNNAVALM
ELYKSAGMSQQWAASSFKGSTTVHTCVTGTQRHVDNHLQWLNVASNLSAGIKLQGIALTG
WQRYDHLSVLCELMPLGLPSLASCLQTLQHGSFTEEVQKKVIETLGTVEVADTERLSPRT
SSTFGGAKLAELIVKLTSSLESAELRHFQNNMFVRGWFTSYHIQKKTVNPLIAQQIKTQA
KMFLDAVEIQVVEVRAEMRLLYSDSTVQEWMDQHVTPVLEPLHNLLRDIDRVLQEMGLCI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtcattgcgcacttgcaaaaagtttgtccatttggacctaaaaggggctcct
cctagaattggttacttcattgagttgatccagttatttgctgatcttggtgccaatggg
ttgctcattgaatatgaggatatgtttccttatgagggagagctgcaagttcttcagtct
aaatctcagcctccatacagccgagaggagattgcgtctatccaggatgctgccagtagc
agagggctggagatcattccgctggtgcagacgtttggacacttggaatttgtcctgaaa
cataaggtgttcagagatctgcgggaggtggactgctgtctgggcaccttgaacccaaac
tgtgatcgaggagtcaagctggtccaagaaatgctaaagcaagtcatgaagctccaccct
aatagtaccagcttacacatcggagccgatgaggtgtacatgctcggtctcggtgatgaa
tccaaacaatggttaactgctccaggtcgaaatgttcaccagctgttcctcggtcatgtc
cttaaagtggcaaaaagcattcaggagagtttgcccaatcttaaattgattatgtgggat
gatatgctcagatccatgacttctgaaactatcaaagaaagtggtcttgttggattagtg
cagccaatgttgtgggattacagccctactctggatgtcaataatgctgttgcgctgatg
gagctatataagtctgctggtatgtcacaacaatgggccgccagctcttttaaaggctcg
accaccgtccacacctgcgtaactgggactcagagacatgtggacaaccatctacagtgg
ctcaatgtagcatcgaatctgtcagctggcatcaaactacagggaattgctctaactgga
tggcaaaggtatgaccacctgtccgttttgtgtgagctgatgcctttgggtttgccctct
ttggcatcgtgtttgcaaactcttcagcacggtagctttactgaagaggtgcaaaagaaa
gtaattgagacacttggcactgtggaagtagcagacacagaaagattatctcccaggacg
tcttctacctttggtggggcgaaactagctgaactcatagtaaagttgacatcttcgctg
gagtctgcagagctgagacattttcagaacaacatgtttgtgagaggctggtttacttct
taccatattcagaagaagactgttaacccacttattgcacaacagattaaaacacaagca
aaaatgtttcttgatgctgtggagatccaggtggtggaggtgagggctgaaatgcgtctg
ctttattcggactctacggtccaggaatggatggatcaacatgttaccccagttctggag
ccgctgcacaacctgctgagagacattgatagagttttacaggaaatgggactctgtatt
taa

DBGET integrated database retrieval system