KEGG   Danio rerio (zebrafish): 565372Help
Entry
565372            CDS       T01004                                 

Gene name
hexdc, fj33c04, wu:fj33c04, zgc:152869
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    565372 (hexdc)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     565372 (hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 480 aa AA seqDB search
MDLSLRTCKKFVHLDLKGAPPRIGYFIELIQLFADLGANGLLIEYEDMFPYEGELQVLQS
KSQPPYSREEIASIQDAASSRGLEIIPLVQTFGHLEFVLKHKVFRDLREVDCCLGTLNPN
CDRGVKLVQEMLKQVMKLHPNSTSLHIGADEVYMLGLGDESKQWLTAPGRNVHQLFLGHV
LKVAKSIQESLPNLKLIMWDDMLRSMTSETIKESGLVGLVQPMLWDYSPTLDVNNAVALM
ELYKSAGMSQQWAASSFKGSTTVHTCVTGTQRHVDNHLQWLNVASNLSAGIKLQGIALTG
WQRYDHLSVLCELMPLGLPSLASCLQTLQHGSFTEEVQKKVIETLGTVEVADTERLSPRT
SSTFGGAKLAELIVKLTSSLESAELRHFQNNMFVRGWFTSYHIQKKTVNPLIAQQIKTQA
KMFLDAVEIQVVEVRAEMRLLYSDSTVQEWMDQHVTPVLEPLHNLLRDIDRVLQEMGLCI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtcattgcgcacttgcaaaaagtttgtccatttggacctaaaaggggctcct
cctagaattggttacttcattgagttgatccagttatttgctgatcttggtgccaatggg
ttgctcattgaatatgaggatatgtttccttatgagggagagctgcaagttcttcagtct
aaatctcagcctccatacagccgagaggagattgcgtctatccaggatgctgccagtagc
agagggctggagatcattccgctggtgcagacgtttggacacttggaatttgtcctgaaa
cataaggtgttcagagatctgcgggaggtggactgctgtctgggcaccttgaacccaaac
tgtgatcgaggagtcaagctggtccaagaaatgctaaagcaagtcatgaagctccaccct
aatagtaccagcttacacatcggagccgatgaggtgtacatgctcggtctcggtgatgaa
tccaaacaatggttaactgctccaggtcgaaatgttcaccagctgttcctcggtcatgtc
cttaaagtggcaaaaagcattcaggagagtttgcccaatcttaaattgattatgtgggat
gatatgctcagatccatgacttctgaaactatcaaagaaagtggtcttgttggattagtg
cagccaatgttgtgggattacagccctactctggatgtcaataatgctgttgcgctgatg
gagctatataagtctgctggtatgtcacaacaatgggccgccagctcttttaaaggctcg
accaccgtccacacctgcgtaactgggactcagagacatgtggacaaccatctacagtgg
ctcaatgtagcatcgaatctgtcagctggcatcaaactacagggaattgctctaactgga
tggcaaaggtatgaccacctgtccgttttgtgtgagctgatgcctttgggtttgccctct
ttggcatcgtgtttgcaaactcttcagcacggtagctttactgaagaggtgcaaaagaaa
gtaattgagacacttggcactgtggaagtagcagacacagaaagattatctcccaggacg
tcttctacctttggtggggcgaaactagctgaactcatagtaaagttgacatcttcgctg
gagtctgcagagctgagacattttcagaacaacatgtttgtgagaggctggtttacttct
taccatattcagaagaagactgttaacccacttattgcacaacagattaaaacacaagca
aaaatgtttcttgatgctgtggagatccaggtggtggaggtgagggctgaaatgcgtctg
ctttattcggactctacggtccaggaatggatggatcaacatgttaccccagttctggag
ccgctgcacaacctgctgagagacattgatagagttttacaggaaatgggactctgtatt
taa

DBGET integrated database retrieval system