KEGG   Danio rerio (zebrafish): 565434Help
Entry
565434            CDS       T01004                                 

Gene name
usp8, wu:fb15f07, wu:fb92h07
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    565434 (usp8)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     565434 (usp8)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   565434 (usp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1067 aa AA seqDB search
MPSVSSGLKDLYLSTSLGDLNKKAEIKPDKSSTRHYVQSACKIFKAAEECRLDRDEERAY
VLYMKYLSVYDLIKKRPDFKQQQEFFLSMLGPTSFKKAIEEAEKLSESLKLRYEEVEVRK
KLEEKERKEEKSRREERTEKKDGRASPQANTERKDSKKQVKEEPNNSKSVCDKGSISAEA
LFRLMKDSSISVLVMDARPALDFQESQISVPSQTCISVPEEAISPGVTVNQMELKLPAES
LSEWKRRGFVDYVVLLDWFSSVSDLRLGSTLQSLKDALYKWDNSTILRSEPLVLDGGYES
WLLFYPMYTSNAKVKPPRQQTPSTLPQLNFTYPSLEEPKPASVCEEPASAAQMNGKPLEA
EPPAEPATNTPPLAHPTNTHTPPLAQPTTTHTPPLAPSATTHTPPLAPSATTHTPPLAPP
AHTEAAAPPTASPRHTPQVDRSKKPSVIPPSSSKLISDPAVSEGPAPPAAHNGPSVPDRS
VKPTTDPSRALSAEQRWEIQKDTLDLMEKAKREQEQRRRAQEQEKLEDKQQDRRKLERQT
AEEEDLKETSPEDKSRKTQKDTPADAPMKSMSLDSPAQFNTREPLTRAHSEEMGRTVPGL
PDGWMKFLDTVTGTYRYYHSPTNRVHLYPPEVSTPQTPAKHTPPAQPAADTETEKQRQRD
REREQSKLKRSYSSPDISQELSAETRQRPAAVPSINRENKPLAASTYAKVEITRPSAAKI
RNLNPVFGGQGPLLTGLRNLGNTCYMNSILQCLCNTVAMADYFNRNYYQDDINRANILGH
KGEVAEEFSVVMKALWLGQYKMISPLDFKGTICKINSRFSSYEHQDSQELLLFLMDGLHE
DLNKADKRRGYKEEEIEHLDDVSAADLAWSKHKQLNESIIVALFQGQFKSTVQCMSCQHK
SRTFETFMYLTLEMTASSKCSLQDCLKLFHKEERLTDGNRFYCRHCKTHRDAIKRMQIWK
LPPILLVHLKRFKYEGRWREKLQTLVDFPLDNLDLSQYVIGPKNNLKKYNLYAVSNHYGG
MDGGHYTAYCKNPMKQRWFKFDDHEVSEISSSTVRSPAAYIFFYSSL
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccgtgtccagcggattgaaggatctctatctgtccacgtcactcggagatctg
aacaagaaggcagaaatcaagccggacaagagcagcaccagacattatgtccagagcgca
tgtaagatcttcaaggcggcagaggagtgtcgtctggaccgtgatgaggagagggcgtat
gtgctgtacatgaagtatctgagcgtctatgacctgatcaagaagaggccggacttcaag
cagcagcaggagtttttcctgtctatgctcggcccgaccagcttcaaaaaggccatcgag
gaggcagagaaactctcagagagtctgaagctgcggtatgaggaggtggaggtgcggaag
aagctggaggagaaagagagaaaagaggaaaagagtcggagagaggagcgaacggagaag
aaggatggacgcgcgtcacctcaggctaacactgagaggaaggacagtaagaagcaggtg
aaagaggagcccaataacagcaagagtgtgtgcgataaaggcagcatcagcgctgaggct
ctgttccggctgatgaaggactccagcatcagtgtgttggtgatggacgctcggcccgcg
ctggactttcaggagtctcagatcagcgtgccgtcgcaaacctgcatcagtgttccagag
gaggccatcagcccaggggtgacggtgaatcagatggagctgaagctgcctgcagagtct
ctgagtgagtggaagcggcgtgggtttgtggattatgtggttctgctggactggttcagc
tccgtctctgacctcaggctgggctccactctccagagtctgaaggacgctctctataag
tgggacaacagcactatcctgcgcagtgagccgctggtgttggacggaggatacgagagc
tggctgctgttttaccccatgtacaccagtaacgctaaagtgaaacccccccgacagcag
acgcccagcacactgccacagctgaacttcacgtacccgtctctggaggagcccaaaccc
gcgagtgtgtgtgaagagccagcatcagctgcacagatgaacggcaaacccctggaggca
gagccgcccgcagaacccgctacaaacacaccaccactcgcccatcccacaaacacacac
acaccaccacttgcccaacctacaaccacacacacaccaccactggctccatctgcaacc
acacacacaccaccactggctccatctgcaaccacacacacaccaccgctggctccacct
gctcacactgaggctgcagcaccgcccactgcctcgcccagacacacaccacaggtggac
cgctccaagaaaccgtcagtgattcccccgtccagctctaagctcatcagtgatcctgca
gtcagcgagggcccggcgccaccagcagcacacaatggtccctctgtgcccgatcgctcc
gtcaaacccaccacagacccctcccgagccctgagcgcggagcagcggtgggagatccag
aaagacacgctggacctgatggagaaggccaagagagagcaggagcagcgcaggagggcc
caggagcaggagaagctggaggacaaacagcaggacaggaggaagctggagcggcagacg
gccgaggaggaggacctgaaggagaccagccctgaagacaagagccgcaaaacacagaag
gacacaccggcggacgccccgatgaagagcatgtctctggactcacctgcacagttcaac
actagggagccactgacccgagcacacagtgaggagatgggcaggacagtcccggggctg
cctgatggctggatgaagtttctggacacggtgacgggcacctacagatattaccactct
cccaccaaccgcgtgcacctgtaccctcctgaagtcagcacaccgcagacgccagccaaa
cacacaccgcccgcgcagccggcagcagacacggagacggagaagcagcggcagcgggac
cgagagagagaacagtccaaactcaagcgctcatactcctctccagacatcagccaggag
ctcagcgcagagaccagacagagacccgctgcagtgcccagcatcaacagagagaacaag
cctctagctgccagcacatatgcgaaggtggagatcacgcgtccgtctgcagcaaagatc
cgcaacctgaacccagtgtttggaggccaggggccgctgctgacgggcctccgcaacctg
gggaacacctgctacatgaactccatcctgcagtgcctgtgcaacaccgtggccatggcg
gactacttcaacaggaactactatcaggacgacattaaccgggcgaatatcctgggtcat
aagggcgaggtggcggaggagttcagcgtggtgatgaaggcgctgtggttgggtcagtat
aagatgatcagcccgctggactttaagggcaccatctgtaagatcaacagccgcttctcc
agctacgagcaccaggactctcaggagctgctgctcttcctgatggacggcctgcatgag
gatctcaacaaggcggacaagcgcaggggctataaggaggaggagatcgagcatctggac
gacgtgagcgcggcggatctggcctggtccaaacacaagcagctgaacgagtccatcatc
gtggctctgtttcagggccagttcaagtccacggttcagtgcatgagctgccagcacaaa
tcacgcaccttcgagaccttcatgtacctgacgctggagatgacggccagcagcaagtgc
tctctgcaggactgtctgaaactgtttcataaagaagagcgtctgactgacggtaaccgc
ttctactgccgccactgtaagacccaccgcgacgccatcaagaggatgcagatctggaag
ctgccgcccatattactggtgcacctgaagcggtttaaatatgagggccgctggcgggag
aagctgcagacgctggtggatttccctctggataatctggacctgtcgcagtacgtcatc
ggacccaaaaacaacctgaagaagtacaacctgtacgccgtgtctaatcactacggcgga
atggacggcggccactacactgcctactgcaagaaccccatgaagcagcgctggttcaag
tttgacgatcacgaggtctccgagatctccagctccacggtgcgctcgcccgcagcttac
atattcttctactcctctctatga

DBGET integrated database retrieval system