KEGG   Danio rerio (zebrafish): 565612Help
Entry
565612            CDS       T01004                                 

Gene name
ep300b, EP300a, P300-B, gb:dq017642, wu:fj84f01
Definition
E1A binding protein p300 b
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    565612 (ep300b)
   04330 Notch signaling pathway
    565612 (ep300b)
   04350 TGF-beta signaling pathway
    565612 (ep300b)
   04630 Jak-STAT signaling pathway
    565612 (ep300b)
   04068 FoxO signaling pathway
    565612 (ep300b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    565612 (ep300b)
  Cellular commiunity
   04520 Adherens junction
    565612 (ep300b)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    565612 (ep300b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    565612 (ep300b)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     565612 (ep300b)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    565612 (ep300b)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    565612 (ep300b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
3
AA seq 2646 aa AA seqDB search
MADNVLDSGPPTAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELINSSDLGLPNGMD
PSQLHTSLGGGGMSGPLGVSGQDTAAKHKHLSELLRPGAPPSASTATGSPGNAASLGMMG
GLSGGPVTQGMGGPQQQPSMMPQPGMVGGLNRAMMGTQKGNGQPQSMMGGQMMNGAPRMG
YANVNMNAGMAGNGNMLPDSLQQPNAGQQMAQAAMRPQQPGAVNKMGMMGAPGPYGGSYG
QCGGQSQLGPQLQNKAGQPNSINQFNMDKKPQLGQNMGGMQGPGVVGGVSGPGGTAAPPA
ADPEKRKLIQQQLVLLLHAHKCHRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQ
VAHCASSRQIISHWKNCTRHDCPVCLPLKSAGDKRNQQSLLGGAGMAMGGPLGGSLPGGQ
PSAPNINPPSQIDPSSIERAYAALGLTYQGNQASNQNQQTSVPGQPGMRSLNNMAGGNSM
GVNGGVGAPMSNQHPGMLPDGMLHRNMTAQSLMNDSSGVGNMGSAATATPPSAGMRKSWH
EDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRAEYYHL
LAEKIYKIQKELEEKRRTRLQKQDGPHSDPSLVQATGPSQMVNRMQNPAGMPHSLNGMNQ
FGQVGMQQPMGQRATPPLPMGANLNQMSMQGTPRMAQPNVPQLQNQYMQNQFTGTGAGLG
QGAVGLNQPAGQGAMPQNQMPTPPSLSVHSPVAQSQSSVPVSGAAAGPQGPPSNHPPPAP
QPGLHTHCPPLRQNSPSPARSLTPTPAPHQTPPQLPGNQTPQPHTPNSSTTMAPPASQLP
PMAQGVASEKSSQLQQQSHGGGATGGPQTGLASSVPSQNAHGLCTHPHSPLSQKSSATVD
GQASTPASVSSADPSSQLTSSEPTAPLDSKTEVKQQDEEEENENETEDKASGKMAAMQTE
IKSEEKPEIKKEEPAGDECKTEPMETSTAEDKKPEVKTEPKEEEVAGANSTPANTQSKKK
EFKPDELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPVRIRTSNKTNLDYFDIVKNP
IDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPV
MQELGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADRYHFCEKCFN
EIQGENVSLGDDPTQPQTSINKDQFQRKKNDTLDPELLLECGDCGRKMHQICVLHNETIW
PSGFICDGCLKKSNSTRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHPESGEVTIRVV
HISDKVVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGTDVCFFGMHVQEYGSDCP
PPNQRRVYISYLDSVHFFQPRHLRTGVYHEILIGYLEYVKKMGFVMGHIWACPPSEGDDY
IFHCHPSDQKIPKPKRLQEWYKKMLDKAVTERIVHDYKDIFKQATEDRLTSAKELPYFEG
DFWPNVLEESIKELEQEEEERKREENNTSSESIDATNGDSKNAKKKNNKKTSKNKSSLSR
ANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRFIAGPAANSLPPISDPDTLMACDLMD
GRDAFLTLARDKHLEFSSLRRAKWSSMCMLVELHNQTQDRFVYTCNECKHHVETRFHCTV
CEDYDLCITCYNVKGHEHKMEKLGLGLDDESNNQAAASTQNPGDSRRLSIQRCIQSLVHA
CQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQETKCPVPF
CLNIKHKLRQQQLQHRLQQAQMLRRRMATMQRVGQPPPCGGGPPGGLPSPGNNGATGPST
PTSVGTQPATPQTPTQLTPNLISLPQPGAGGVPAGAPQQSPQHPVHHQFQQMPGAGGMMN
SQQQQMVPQQSLGQVPHPHNQYGPHPTGPSPNTQSQGKPGLGPATPPQLPSNPGTVPMAQ
QQQPTGPPAAAVEIAMKIQQVADAQRKMAQVQLLQRQAAQAGMMPQHHQQPQGQIGVAHP
GIGMVGPQGLASQAQTSANRVQMEQQQGPQGMMGAGPMQQQQPQQVAVQGQMPPQMHPQQ
PRMNPPLQPQQQQWPGQGMPTQQRPAMMSQQGMVSMQPQPQPQQPSQQTQQQQAPQMPNR
NALMSMVQAGLQSGVASGAAASNLPQGALQQLLRTLRSPSSPQQQQQVLNILRSSPLLMA
AFIKQRVHKYKGGTGGPSGPQGGPGPMGGQPVGVNTGVPQPGMHLGQGVNMQSQLLSQQQ
SQQQQQMQQRPLLQQQQVAALQQQQQQQQQQQQQQQQQQHQQQQQQQQHQQQQQQQQGIQ
GQGTPNMANPHFRELVMRRQQQLQFQQQQQQQQQQQQQQMSNHAAFQQQQGYMSQQGNMQ
VPPGGQPLQGVQPGQQQNFPGNPAQQQAAAALQQRLAQQQHQLQMQQQQNAATQGPDMGP
GGGPQPTQLGPGLQSPQALLQQALHQRLFPQQQHLSGTSPAQQNNPMSPQQQQISQSPHL
QGQQLPSSLSNQVCSPQPSPRPQSQPPHSSPSPRLQPQPSPHHISPQTQTGSPHPSHLQQ
HHSGMAPPPPPHQQPQHNSKDPSGFGADQNAMLSQLSGMAGLHGPGANDMLPPSGQDLGI
NMNLTL
NT seq 7941 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtgctggactccggtccgcctacagctaagaggcctaaattgtcttcc
ccggctctgtcggtctccgcaagcgatggaaacgattttggctctctgtttgacctggag
catgacctcccagatgagctcattaactcctccgacctgggccttccaaacgggatggac
cccagccagttgcacaccagtctgggtggaggagggatgtcaggccctttgggcgtctcg
ggccaagacactgcggccaaacacaagcacctgtctgagctcctccgccctggtgctcct
ccatccgcctccacggccaccggcagccccggtaacgctgcctccttaggaatgatggga
ggtctgagcggtggccctgttactcagggaatgggtggccctcagcagcagcctagcatg
atgccgcagcctggcatggtggggggactgaaccgagccatgatgggcacccagaaaggg
aatggacagccgcagagtatgatgggtgggcagatgatgaatggtgcacctagaatgggc
tacgccaatgtgaacatgaatgcaggcatggctggcaacgggaatatgctgcccgattct
ctgcagcagccaaatgcagggcagcagatggcacaggcagcaatgagaccgcagcaacca
ggagcagtgaacaagatggggatgatgggtgctccaggcccgtatggcggttcatatggt
cagtgcggaggacagtctcaacttgggcctcaactccaaaacaaagcgggtcaaccaaac
agcattaaccagtttaatatggacaagaaacctcagcttgggcagaacatgggtggcatg
cagggcccaggtgtggtgggtggtgtatcggggccaggtgggacggcagcgccccctgcc
gcggacccagagaagcgtaaactgattcagcagcagctggtgctgttactgcacgctcac
aagtgccatcgcagagagcaggccaacggagaggtccgccagtgcaacctgcctcactgc
agaaccatgaagaacgtcctcaatcacatgacgcactgtcaggccggcaaatcctgccag
gtggctcactgcgcgtcctccagacagatcatctctcattggaagaactgcacacggcat
gactgtcctgtctgcctgccgctaaagagcgccggagacaaaagaaaccagcaatctcta
ttgggaggtgctgggatggccatgggtggtcctttaggtgggtcattacctggtggccaa
ccttcagctccaaacattaacccacccagtcagattgacccaagctccatcgagagggcg
tatgctgctcttggactcacttaccaagggaaccaagcatccaatcaaaatcagcagacc
tctgtacccggtcaacctggcatgaggtcgctcaacaacatggcaggtgggaactcaatg
ggagtgaatggaggagtcggtgcgccgatgtcaaaccagcatccaggaatgctgcccgat
ggcatgctgcacaggaacatgaccgctcagagcttgatgaatgacagctctggtgttggt
aacatgggctctgctgcgaccgctacaccgccctctgctggaatgaggaagagctggcat
gaagacatcacacaggacctccgcaatcaccttgtacacaaacttgtacaggccatcttc
ccgactccagaccctgcagcgctgaaggacaggcggatggaaaaccttgtagcttatgca
cggaaagtggagggcgacatgtacgaatctgcaaatagcagggcggagtattaccacttg
ttggcggagaagatatataagattcagaaggagctggaggagaagaggagaaccagactc
caaaagcaggatggtcctcattcagatccgtctttagttcaagccactggtcccagtcag
atggtcaatcgcatgcagaatcctgctggtatgccacactcactaaatggtatgaatcaa
tttggccaggtggggatgcagcaaccaatgggacagagggccacgcctcccctgccaatg
ggtgcaaacctcaatcagatgagcatgcagggaacacctcgaatggctcagcccaatgta
ccccagttacaaaaccagtacatgcagaaccagtttacaggaacgggtgctggattggga
cagggtgcggttggcctgaatcaacctgcagggcagggagccatgccgcagaatcagatg
cccactccaccatcactatcagtccatagtcctgtagctcagtcccagtcgtcagtccca
gtctctggagccgctgctggccctcaggggcctccgtccaaccaccctccacctgctcct
cagcccggtctgcacacgcactgtcctcccttacgccaaaactccccttctcccgcacgt
agcctcacccctacccctgccccgcaccaaacacccccgcagttgcctggtaaccagacc
cctcagccccacacccctaattcatccaccactatggctccacctgcatcacagctgccc
cctatggcacagggggtggcctccgaaaaatccagtcagttacaacagcagtcgcatgga
ggtggagctactggaggcccccaaacagggctggcgtcatctgtgccttcccagaacgcc
cacgggctttgtacacacccacatagtcctctctctcagaaatcatctgcgactgtggac
ggtcaggcctcgactcctgcctcagtcagcagtgctgaccctagttcacaactgacatca
tccgaacccacagcccctcttgactccaaaactgaggtcaaacagcaggatgaagaggaa
gagaatgagaatgagactgaggacaaggcctcagggaaaatggccgccatgcagaccgag
atcaagtctgaggagaaaccagagataaagaaggaggagcctgcaggtgatgaatgtaag
acggagccaatggagacatccacagccgaggacaagaagccggaggtcaaaactgaaccc
aaagaggaggaggttgcaggagccaacagcactcccgcaaacacacaaagcaagaagaaa
gaatttaaaccagatgagctccgccaggctttaatgcccactctggaagctctgtacaga
caggacccagagtcgctgcccttccggcagccggtggacccccagttactgggaataccc
gtacgtattcgaactagtaacaaaactaacctggactactttgacattgtgaaaaacccc
atagacttgtccactatcaagcgtaagctggacacggggcagtaccaggagccctggcag
tatgtggatgacgtgtggctgatgttcaataacgcctggctgtataacagaaagacgtca
cgggtttataaatactgctccaaactggccgaggtcttcgaacaggaaatagaccctgtt
atgcaggagttgggctactgctgtggaaggaagttggagttttctcctcaaactctgtgc
tgctatggcaaacagctgtgtaccatcccccgagatgctgcgtacttcagttaccagaac
agttcacccaaatatgggcttcttgctgacaggtaccacttctgtgagaagtgtttcaac
gaaatccagggggagaatgtgtccctgggggacgacccaacccagccacaaacgtccatc
aataaagaccagtttcaacgtaagaagaacgacaccctcgaccctgagctactgctggaa
tgtggcgactgtggtcgaaaaatgcatcagatttgcgttctgcacaatgagacaatatgg
ccgtcagggtttatctgtgacggctgtctgaaaaaatccaattccacaaggaaggaaaat
aaatatgcagcaaagaggcttcctcagacaaagcttggcaactttctggagacacgagtg
aacgattacctgaagcgccagaatcatccagaatctggtgaagtcaccatccgggtggtg
cacatctctgataaagtggtggaggtcaagcctggcatgaagtccagatttgttgatagc
ggcgagatgtcagaatcattcccatataggacaaaagctctgtttgcatttgaggagatt
gacggaacagatgtctgcttctttggaatgcatgttcaagaatacggctctgattgccct
ccacctaatcaaagacgtgtgtatatatcctatctagacagtgtgcactttttccaaccc
cgtcatttgagaacaggagtctaccatgaaattctcataggatacttagagtacgttaag
aaaatggggtttgtcatgggccacatctgggcttgtccaccgagtgaaggtgatgactac
atctttcactgccatccatctgatcagaagattcccaaaccaaaacgcttacaagagtgg
tacaagaagatgcttgacaaagcagtaactgagagaattgtacatgactacaaggacatt
tttaagcaggcaactgaggatcgtctgaccagtgcgaaggagctcccttattttgagggt
gacttttggcctaacgtattggaggagagcatcaaagagctggaacaggaggaggaagaa
cggaagagagaggaaaataacacctctagtgaaagtattgatgcgaccaatggtgacagc
aaaaatgccaaaaagaagaacaataaaaagactagcaagaacaagagcagcttgagtcga
gccaataaaaagaaaccaggcatgccaaatgtctccaatgatctatcccagaaactttat
gctacaatggagaaacacaaagaggttttctttgttatccgtttcatcgctggccctgct
gccaattctcttccacccatttcggaccctgacacgctaatggcctgtgatctgatggac
ggccgagatgctttcttaacgctagcacgagacaagcaccttgaattcagctcattgagg
agggccaaatggagctccatgtgtatgttagtagaattgcacaatcagactcaggaccgc
ttcgtctacacatgcaatgaatgcaaacaccatgttgagacgcgcttccattgcactgtt
tgtgaggattatgatctttgcatcacttgctacaacgttaagggccacgagcacaagatg
gagaaacttggactgggtcttgatgatgagagcaacaaccaagctgctgcctccacccag
aaccctggtgactcgcgtcgtctcagcatccagcgctgcatccagtctctggtgcatgct
tgccagtgccgcaatgctaattgctcgctgccatcttgccagaagatgaagagagtagtg
caacatacaaaaggctgcaagcgcaagaccaatggtggctgtccaatctgcaagcagctc
attgcactatgctgctatcatgctaagcactgccaggaaactaagtgtcctgtgcccttc
tgtctcaacatcaagcacaagcttcgtcagcagcagttgcaacataggcttcagcaagcg
caaatgctgcgtagacgtatggccactatgcagcgagtagggcagccaccaccatgtgga
ggtgggcctccaggaggtcttccatcacctggcaacaatggagcaacaggtcctagcaca
cctacgtcagttggtacgcagccggcaacaccccagacgcccacacagctgacacccaat
cttatatctttgccccagcctggtgcaggaggagtcccagctggagctccccagcagtct
cctcagcatcctgtccaccaccagtttcagcagatgcctggagcaggaggcatgatgaat
tcacagcaacaacaaatggttcctcagcaatcattgggacaagtgccacatccacacaat
caatatggcccccaccccacaggtccctccccaaatacccagtcccagggtaaaccaggc
cttggtcctgcaactcctccgcaactccccagcaacccaggcactgtacctatggcccag
caacaacaacctacaggtcctccggcagccgctgtggagattgccatgaagattcagcaa
gtggcagatgcacagcggaaaatggcacaggttcagttgctacaaagacaagctgcccaa
gcaggaatgatgccacagcaccatcagcagccacagggacagattggagtggcccatcct
ggaattggtatggtagggccacaaggcttagcctcgcaggcacaaacatcagcgaacagg
gtgcagatggagcagcaacaaggacctcagggaatgatgggagccgggcccatgcagcaa
cagcagcctcaacaggtcgctgtgcaaggtcagatgcccccacaaatgcatccacagcag
ccgagaatgaatccaccacttcagcctcaacagcaacagtggccagggcagggcatgcct
acccagcagagacctgctatgatgtctcagcagggaatggtttcaatgcagccccaaccg
cagccgcaacaaccatcacaacaaacgcaacagcagcaagcaccccaaatgccaaatcga
aatgccttgatgagtatggtacaggctggtctacagagtggcgtagcaagtggggctgca
gctagcaatttgccccagggagccttgcagcagcttttgcggactctgcgatctccaagc
tctcctcaacagcaacagcaagttctcaacattctccggtctagcccacttctaatggca
gcatttatcaagcaacgggttcacaagtataaaggaggtacaggtggcccctctggaccg
cagggagggccaggacctatgggaggccaacctgtgggtgtcaatactggggttccccaa
cctggtatgcatcttggacaaggtgttaacatgcagagtcaacttctgagtcaacaacag
agccaacagcagcagcaaatgcaacaacgaccgctcctgcaacaacagcaagttgctgcc
ttgcagcagcagcaacaacaacaacaacagcagcagcaacaacaacagcagcagcagcac
caacaacaacaacagcagcagcagcaccaacaacaacagcagcagcagcaagggattcaa
ggacaggggaccccaaacatggccaatccacacttccgagaactagtcatgagaaggcaa
cagcaattacagtttcagcagcaacagcagcaacaacagcaacaacaacaacaacaaatg
agcaatcatgcggcattccagcagcagcaaggttacatgagtcagcagggtaacatgcaa
gtcccgccaggaggtcagccactgcaaggagtacaacctggccaacagcagaattttcct
ggaaatcctgcacagcaacaagctgcagctgctttgcaacagaggcttgcgcagcagcaa
catcagctacagatgcaacagcagcagaatgctgcaacacaaggtcctgacatgggacct
ggaggaggtccacagcccacacaactaggtccaggtcttcagtcaccacaggcattattg
caacaggctttgcatcagcgtctatttccgcagcagcagcatcttagtggcacctctccg
gcacagcaaaacaacccaatgagtccacagcagcaacagatatctcagtcgccccacttg
cagggccagcagctcccatcctccctcagcaaccaggtctgttcaccacagccatctcca
cgaccccagtcccagccacctcactcaagtccgtccccacgcctgcaacctcagccctca
cctcaccacatctcgcctcaaacccaaacaggttctccgcatcccagccatcttcagcag
catcactcaggcatggctccacctcctccaccccaccaacagccacagcacaactctaag
gacccaagcggatttggcgcagatcagaatgccatgctttctcaactcagtggcatggcg
ggactccacggaccaggagcgaatgatatgctgcctcctagtggccaggaccttggcatt
aacatgaatctaaccctttag

DBGET integrated database retrieval system