KEGG   Danio rerio (zebrafish): 565612Help
Entry
565612            CDS       T01004                                 

Gene name
ep300b, EP300a, P300-B, gb:dq017642, wu:fj84f01
Definition
(RefSeq) E1A binding protein p300 b
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    565612 (ep300b)
   04330 Notch signaling pathway
    565612 (ep300b)
   04350 TGF-beta signaling pathway
    565612 (ep300b)
   04068 FoxO signaling pathway
    565612 (ep300b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    565612 (ep300b)
  Cellular community - eukaryotes
   04520 Adherens junction
    565612 (ep300b)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    565612 (ep300b)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    565612 (ep300b)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     565612 (ep300b)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    565612 (ep300b)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    565612 (ep300b)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    565612 (ep300b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
3
AA seq 2646 aa AA seqDB search
MADNVLDSGPPTAKRPKLSSPALSVSASDGNDFGSLFDLEHDLPDELINSSDLGLPNGMD
PSQLHTSLGGGGMSGPLGVSGQDTAAKHKHLSELLRPGAPPSASTATGSPGNAASLGMMG
GLSGGPVTQGMGGPQQQPSMMPQPGMVGGLNRAMMGTQKGNGQPQSMMGGQMMNGAPRMG
YANVNMNAGMAGNGNMLPDSLQQPNAGQQMAQAAMRPQQPGAVNKMGMMGAPGPYGGSYG
QCGGQSQLGPQLQNKAGQPNSINQFNMDKKPQLGQNMGGMQGPGVVGGVSGPGGTAAPPA
ADPEKRKLIQQQLVLLLHAHKCHRREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQ
VAHCASSRQIISHWKNCTRHDCPVCLPLKSAGDKRNQQSLLGGAGMAMGGPLGGSLPGGQ
PSAPNINPPSQIDPSSIERAYAALGLTYQGNQASNQNQQTSVPGQPGMRSLNNMAGGNSM
GVNGGVGAPMSNQHPGMLPDGMLHRNMTAQSLMNDSSGVGNMGSAATATPPSAGMRKSWH
EDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRAEYYHL
LAEKIYKIQKELEEKRRTRLQKQDGPHSDPSLVQATGPSQMVNRMQNPAGMPHSLNGMNQ
FGQVGMQQPMGQRATPPLPMGANLNQMSMQGTPRMAQPNVPQLQNQYMQNQFTGTGAGLG
QGAVGLNQPAGQGAMPQNQMPTPPSLSVHSPVAQSQSSVPVSGAAAGPQGPPSNHPPPAP
QPGLHTHCPPLRQNSPSPARSLTPTPAPHQTPPQLPGNQTPQPHTPNSSTTMAPPASQLP
PMAQGVASEKSSQLQQQSHGGGATGGPQTGLASSVPSQNAHGLCTHPHSPLSQKSSATVD
GQASTPASVSSADPSSQLTSSEPTAPLDSKTEVKQQDEEEENENETEDKASGKMAAMQTE
IKSEEKPEIKKEEPAGDECKTEPMETSTAEDKKPEVKTEPKEEEVAGANSTPANTQSKKK
EFKPDELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPVRIRTSNKTNLDYFDIVKNP
IDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPV
MQELGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADRYHFCEKCFN
EIQGENVSLGDDPTQPQTSINKDQFQRKKNDTLDPELLLECGDCGRKMHQICVLHNETIW
PSGFICDGCLKKSNSTRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHPESGEVTIRVV
HISDKVVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGTDVCFFGMHVQEYGSDCP
PPNQRRVYISYLDSVHFFQPRHLRTGVYHEILIGYLEYVKKMGFVMGHIWACPPSEGDDY
IFHCHPSDQKIPKPKRLQEWYKKMLDKAVTERIVHDYKDIFKQATEDRLTSAKELPYFEG
DFWPNVLEESIKELEQEEEERKREENNTSSESIDATNGDSKNAKKKNNKKTSKNKSSLSR
ANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRFIAGPAANSLPPISDPDTLMACDLMD
GRDAFLTLARDKHLEFSSLRRAKWSSMCMLVELHNQTQDRFVYTCNECKHHVETRFHCTV
CEDYDLCITCYNVKGHEHKMEKLGLGLDDESNNQAAASTQNPGDSRRLSIQRCIQSLVHA
CQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQETKCPVPF
CLNIKHKLRQQQLQHRLQQAQMLRRRMATMQRVGQPPPCGGGPPGGLPSPGNNGATGPST
PTSVGTQPATPQTPTQLTPNLISLPQPGAGGVPAGAPQQSPQHPVHHQFQQMPGAGGMMN
SQQQQMVPQQSLGQVPHPHNQYGPHPTGPSPNTQSQGKPGLGPATPPQLPSNPGTVPMAQ
QQQPTGPPAAAVEIAMKIQQVADAQRKMAQVQLLQRQAAQAGMMPQHHQQPQGQIGVAHP
GIGMVGPQGLASQAQTSANRVQMEQQQGPQGMMGAGPMQQQQPQQVAVQGQMPPQMHPQQ
PRMNPPLQPQQQQWPGQGMPTQQRPAMMSQQGMVSMQPQPQPQQPSQQTQQQQAPQMPNR
NALMSMVQAGLQSGVASGAAASNLPQGALQQLLRTLRSPSSPQQQQQVLNILRSSPLLMA
AFIKQRVHKYKGGTGGPSGPQGGPGPMGGQPVGVNTGVPQPGMHLGQGVNMQSQLLSQQQ
SQQQQQMQQRPLLQQQQVAALQQQQQQQQQQQQQQQQQQHQQQQQQQQHQQQQQQQQGIQ
GQGTPNMANPHFRELVMRRQQQLQFQQQQQQQQQQQQQQMSNHAAFQQQQGYMSQQGNMQ
VPPGGQPLQGVQPGQQQNFPGNPAQQQAAAALQQRLAQQQHQLQMQQQQNAATQGPDMGP
GGGPQPTQLGPGLQSPQALLQQALHQRLFPQQQHLSGTSPAQQNNPMSPQQQQISQSPHL
QGQQLPSSLSNQVCSPQPSPRPQSQPPHSSPSPRLQPQPSPHHISPQTQTGSPHPSHLQQ
HHSGMAPPPPPHQQPQHNSKDPSGFGADQNAMLSQLSGMAGLHGPGANDMLPPSGQDLGI
NMNLTL
NT seq 7941 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtgctggactccggtccgcctacagctaagaggcctaaattgtcttcc
ccggctctgtcggtctccgcaagcgatggaaacgattttggctctctgtttgacctggag
catgacctcccagatgagctcattaactcctccgacctgggccttccaaacgggatggac
cccagccagttgcacaccagtctgggtggaggagggatgtcaggccctttgggcgtctcg
ggccaagacactgcggccaaacacaagcacctgtctgagctcctccgccctggtgctcct
ccatccgcctccacggccaccggcagccccggtaacgctgcctccttaggaatgatggga
ggtctgagcggtggccctgttactcagggaatgggtggccctcagcagcagcctagcatg
atgccgcagcctggcatggtggggggactgaaccgagccatgatgggcacccagaaaggg
aatggacagccgcagagtatgatgggtgggcagatgatgaatggtgcacctagaatgggc
tacgccaatgtgaacatgaatgcaggcatggctggcaacgggaatatgctgcccgattct
ctgcagcagccaaatgcagggcagcagatggcacaggcagcaatgagaccgcagcaacca
ggagcagtgaacaagatggggatgatgggtgctccaggcccgtatggcggttcatatggt
cagtgcggaggacagtctcaacttgggcctcaactccaaaacaaagcgggtcaaccaaac
agcattaaccagtttaatatggacaagaaacctcagcttgggcagaacatgggtggcatg
cagggcccaggtgtggtgggtggtgtatcggggccaggtgggacggcagcgccccctgcc
gcggacccagagaagcgtaaactgattcagcagcagctggtgctgttactgcacgctcac
aagtgccatcgcagagagcaggccaacggagaggtccgccagtgcaacctgcctcactgc
agaaccatgaagaacgtcctcaatcacatgacgcactgtcaggccggcaaatcctgccag
gtggctcactgcgcgtcctccagacagatcatctctcattggaagaactgcacacggcat
gactgtcctgtctgcctgccgctaaagagcgccggagacaaaagaaaccagcaatctcta
ttgggaggtgctgggatggccatgggtggtcctttaggtgggtcattacctggtggccaa
ccttcagctccaaacattaacccacccagtcagattgacccaagctccatcgagagggcg
tatgctgctcttggactcacttaccaagggaaccaagcatccaatcaaaatcagcagacc
tctgtacccggtcaacctggcatgaggtcgctcaacaacatggcaggtgggaactcaatg
ggagtgaatggaggagtcggtgcgccgatgtcaaaccagcatccaggaatgctgcccgat
ggcatgctgcacaggaacatgaccgctcagagcttgatgaatgacagctctggtgttggt
aacatgggctctgctgcgaccgctacaccgccctctgctggaatgaggaagagctggcat
gaagacatcacacaggacctccgcaatcaccttgtacacaaacttgtacaggccatcttc
ccgactccagaccctgcagcgctgaaggacaggcggatggaaaaccttgtagcttatgca
cggaaagtggagggcgacatgtacgaatctgcaaatagcagggcggagtattaccacttg
ttggcggagaagatatataagattcagaaggagctggaggagaagaggagaaccagactc
caaaagcaggatggtcctcattcagatccgtctttagttcaagccactggtcccagtcag
atggtcaatcgcatgcagaatcctgctggtatgccacactcactaaatggtatgaatcaa
tttggccaggtggggatgcagcaaccaatgggacagagggccacgcctcccctgccaatg
ggtgcaaacctcaatcagatgagcatgcagggaacacctcgaatggctcagcccaatgta
ccccagttacaaaaccagtacatgcagaaccagtttacaggaacgggtgctggattggga
cagggtgcggttggcctgaatcaacctgcagggcagggagccatgccgcagaatcagatg
cccactccaccatcactatcagtccatagtcctgtagctcagtcccagtcgtcagtccca
gtctctggagccgctgctggccctcaggggcctccgtccaaccaccctccacctgctcct
cagcccggtctgcacacgcactgtcctcccttacgccaaaactccccttctcccgcacgt
agcctcacccctacccctgccccgcaccaaacacccccgcagttgcctggtaaccagacc
cctcagccccacacccctaattcatccaccactatggctccacctgcatcacagctgccc
cctatggcacagggggtggcctccgaaaaatccagtcagttacaacagcagtcgcatgga
ggtggagctactggaggcccccaaacagggctggcgtcatctgtgccttcccagaacgcc
cacgggctttgtacacacccacatagtcctctctctcagaaatcatctgcgactgtggac
ggtcaggcctcgactcctgcctcagtcagcagtgctgaccctagttcacaactgacatca
tccgaacccacagcccctcttgactccaaaactgaggtcaaacagcaggatgaagaggaa
gagaatgagaatgagactgaggacaaggcctcagggaaaatggccgccatgcagaccgag
atcaagtctgaggagaaaccagagataaagaaggaggagcctgcaggtgatgaatgtaag
acggagccaatggagacatccacagccgaggacaagaagccggaggtcaaaactgaaccc
aaagaggaggaggttgcaggagccaacagcactcccgcaaacacacaaagcaagaagaaa
gaatttaaaccagatgagctccgccaggctttaatgcccactctggaagctctgtacaga
caggacccagagtcgctgcccttccggcagccggtggacccccagttactgggaataccc
gtacgtattcgaactagtaacaaaactaacctggactactttgacattgtgaaaaacccc
atagacttgtccactatcaagcgtaagctggacacggggcagtaccaggagccctggcag
tatgtggatgacgtgtggctgatgttcaataacgcctggctgtataacagaaagacgtca
cgggtttataaatactgctccaaactggccgaggtcttcgaacaggaaatagaccctgtt
atgcaggagttgggctactgctgtggaaggaagttggagttttctcctcaaactctgtgc
tgctatggcaaacagctgtgtaccatcccccgagatgctgcgtacttcagttaccagaac
agttcacccaaatatgggcttcttgctgacaggtaccacttctgtgagaagtgtttcaac
gaaatccagggggagaatgtgtccctgggggacgacccaacccagccacaaacgtccatc
aataaagaccagtttcaacgtaagaagaacgacaccctcgaccctgagctactgctggaa
tgtggcgactgtggtcgaaaaatgcatcagatttgcgttctgcacaatgagacaatatgg
ccgtcagggtttatctgtgacggctgtctgaaaaaatccaattccacaaggaaggaaaat
aaatatgcagcaaagaggcttcctcagacaaagcttggcaactttctggagacacgagtg
aacgattacctgaagcgccagaatcatccagaatctggtgaagtcaccatccgggtggtg
cacatctctgataaagtggtggaggtcaagcctggcatgaagtccagatttgttgatagc
ggcgagatgtcagaatcattcccatataggacaaaagctctgtttgcatttgaggagatt
gacggaacagatgtctgcttctttggaatgcatgttcaagaatacggctctgattgccct
ccacctaatcaaagacgtgtgtatatatcctatctagacagtgtgcactttttccaaccc
cgtcatttgagaacaggagtctaccatgaaattctcataggatacttagagtacgttaag
aaaatggggtttgtcatgggccacatctgggcttgtccaccgagtgaaggtgatgactac
atctttcactgccatccatctgatcagaagattcccaaaccaaaacgcttacaagagtgg
tacaagaagatgcttgacaaagcagtaactgagagaattgtacatgactacaaggacatt
tttaagcaggcaactgaggatcgtctgaccagtgcgaaggagctcccttattttgagggt
gacttttggcctaacgtattggaggagagcatcaaagagctggaacaggaggaggaagaa
cggaagagagaggaaaataacacctctagtgaaagtattgatgcgaccaatggtgacagc
aaaaatgccaaaaagaagaacaataaaaagactagcaagaacaagagcagcttgagtcga
gccaataaaaagaaaccaggcatgccaaatgtctccaatgatctatcccagaaactttat
gctacaatggagaaacacaaagaggttttctttgttatccgtttcatcgctggccctgct
gccaattctcttccacccatttcggaccctgacacgctaatggcctgtgatctgatggac
ggccgagatgctttcttaacgctagcacgagacaagcaccttgaattcagctcattgagg
agggccaaatggagctccatgtgtatgttagtagaattgcacaatcagactcaggaccgc
ttcgtctacacatgcaatgaatgcaaacaccatgttgagacgcgcttccattgcactgtt
tgtgaggattatgatctttgcatcacttgctacaacgttaagggccacgagcacaagatg
gagaaacttggactgggtcttgatgatgagagcaacaaccaagctgctgcctccacccag
aaccctggtgactcgcgtcgtctcagcatccagcgctgcatccagtctctggtgcatgct
tgccagtgccgcaatgctaattgctcgctgccatcttgccagaagatgaagagagtagtg
caacatacaaaaggctgcaagcgcaagaccaatggtggctgtccaatctgcaagcagctc
attgcactatgctgctatcatgctaagcactgccaggaaactaagtgtcctgtgcccttc
tgtctcaacatcaagcacaagcttcgtcagcagcagttgcaacataggcttcagcaagcg
caaatgctgcgtagacgtatggccactatgcagcgagtagggcagccaccaccatgtgga
ggtgggcctccaggaggtcttccatcacctggcaacaatggagcaacaggtcctagcaca
cctacgtcagttggtacgcagccggcaacaccccagacgcccacacagctgacacccaat
cttatatctttgccccagcctggtgcaggaggagtcccagctggagctccccagcagtct
cctcagcatcctgtccaccaccagtttcagcagatgcctggagcaggaggcatgatgaat
tcacagcaacaacaaatggttcctcagcaatcattgggacaagtgccacatccacacaat
caatatggcccccaccccacaggtccctccccaaatacccagtcccagggtaaaccaggc
cttggtcctgcaactcctccgcaactccccagcaacccaggcactgtacctatggcccag
caacaacaacctacaggtcctccggcagccgctgtggagattgccatgaagattcagcaa
gtggcagatgcacagcggaaaatggcacaggttcagttgctacaaagacaagctgcccaa
gcaggaatgatgccacagcaccatcagcagccacagggacagattggagtggcccatcct
ggaattggtatggtagggccacaaggcttagcctcgcaggcacaaacatcagcgaacagg
gtgcagatggagcagcaacaaggacctcagggaatgatgggagccgggcccatgcagcaa
cagcagcctcaacaggtcgctgtgcaaggtcagatgcccccacaaatgcatccacagcag
ccgagaatgaatccaccacttcagcctcaacagcaacagtggccagggcagggcatgcct
acccagcagagacctgctatgatgtctcagcagggaatggtttcaatgcagccccaaccg
cagccgcaacaaccatcacaacaaacgcaacagcagcaagcaccccaaatgccaaatcga
aatgccttgatgagtatggtacaggctggtctacagagtggcgtagcaagtggggctgca
gctagcaatttgccccagggagccttgcagcagcttttgcggactctgcgatctccaagc
tctcctcaacagcaacagcaagttctcaacattctccggtctagcccacttctaatggca
gcatttatcaagcaacgggttcacaagtataaaggaggtacaggtggcccctctggaccg
cagggagggccaggacctatgggaggccaacctgtgggtgtcaatactggggttccccaa
cctggtatgcatcttggacaaggtgttaacatgcagagtcaacttctgagtcaacaacag
agccaacagcagcagcaaatgcaacaacgaccgctcctgcaacaacagcaagttgctgcc
ttgcagcagcagcaacaacaacaacaacagcagcagcaacaacaacagcagcagcagcac
caacaacaacaacagcagcagcagcaccaacaacaacagcagcagcagcaagggattcaa
ggacaggggaccccaaacatggccaatccacacttccgagaactagtcatgagaaggcaa
cagcaattacagtttcagcagcaacagcagcaacaacagcaacaacaacaacaacaaatg
agcaatcatgcggcattccagcagcagcaaggttacatgagtcagcagggtaacatgcaa
gtcccgccaggaggtcagccactgcaaggagtacaacctggccaacagcagaattttcct
ggaaatcctgcacagcaacaagctgcagctgctttgcaacagaggcttgcgcagcagcaa
catcagctacagatgcaacagcagcagaatgctgcaacacaaggtcctgacatgggacct
ggaggaggtccacagcccacacaactaggtccaggtcttcagtcaccacaggcattattg
caacaggctttgcatcagcgtctatttccgcagcagcagcatcttagtggcacctctccg
gcacagcaaaacaacccaatgagtccacagcagcaacagatatctcagtcgccccacttg
cagggccagcagctcccatcctccctcagcaaccaggtctgttcaccacagccatctcca
cgaccccagtcccagccacctcactcaagtccgtccccacgcctgcaacctcagccctca
cctcaccacatctcgcctcaaacccaaacaggttctccgcatcccagccatcttcagcag
catcactcaggcatggctccacctcctccaccccaccaacagccacagcacaactctaag
gacccaagcggatttggcgcagatcagaatgccatgctttctcaactcagtggcatggcg
ggactccacggaccaggagcgaatgatatgctgcctcctagtggccaggaccttggcatt
aacatgaatctaaccctttag

DBGET integrated database retrieval system