KEGG   Danio rerio (zebrafish): 565669Help
Entry
565669            CDS       T01004                                 

Gene name
plcd4a
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04933  AGE-RAGE signaling pathway in diabetic complications
Module
dre_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    565669 (plcd4a)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    565669 (plcd4a)
   04070 Phosphatidylinositol signaling system
    565669 (plcd4a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    565669 (plcd4a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     565669 (plcd4a)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    565669 (plcd4a)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    565669 (plcd4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 S_100 PH_12 DUF4028
Motif
Other DBs
NCBI-GeneID: 565669
NCBI-ProteinID: XP_694028
ZFIN: ZDB-GENE-050208-654
Ensembl: ENSDARG00000057975
Vega: OTTDARG00000009516
UniProt: F1Q5G9
Position
22
AA seq 761 aa AA seqDB search
MTERQMASTERSLRIQADDDLKSMIVGTVMRKIKSRTWKKQRYFRLQEDCMTIWYQSKKA
GNAHSTFSVGDVEAVREGHQSEVLLSIADEFPPDRCFTLVFRGRRGNLDLVAESTKEAQS
WIKGIRKLIDNLENMGQREKLDQWICDWFKKADKNRDGRMNFKEVRDLLKMMNVDMNEHH
ALRLFTMADRSQSGTLEDDEFVLFYKMLTQREDILRVFQEYSADGQKLTLKDLKDFLQEE
QLHEDGVQQYALNLIERFEPSDTAKMLQAMTFDGFLMYLSSSEGSIFNPAMLELYQDMSQ
PLCHYFISSSHNTYLLEDQIRGLSSVEGYIRALKRGCRCVEVDCWDGPNGEPIVYHGHTF
TSKIFFKDVVTVLGNYSFKASEYPVILSIENHCSVEQQKIMAQHLTQILGDKLLKSTLDG
KIPLGLPSPEDLKGKILLKGKKIGGLEDGMNGVVDDPLMGEVSDEEEATEIEDENHRNNS
IRHRSKKSKQRLSKELSDCVVYCKSVHFSSFKHSRNHSKFYEISSFTESKARKHIREAGA
EFVLHNARQLSRVYPSGLRTDSSNFNPQDLWNAGCQIVALNFQTAGVEMDLNDGLFNQNG
RCGYVLKPAFMRNFEEMFDPENPQNREDYKPLSLSIQVISGQQLPKVNIKEGSIIDPFVR
VEIHGVPLDQAKQETRYIDNNGFNPVWYDTLQFTIHAPELALVRFVVEDYDKTSKNDFVG
QFTLPFTCIQPGYRHIHLLSKDGTSIPPSSLFVHIRITNLT
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgacagatggcttctactgaaaggagcctacgtatccaggctgatgatgac
ctgaagtccatgattgttggcacagtgatgagaaaaatcaagtctcgcacatggaaaaag
cagcgttacttcaggctacaagaagactgcatgactatctggtaccagagcaagaaagca
ggaaatgcccactccaccttttctgtgggtgatgttgaggctgtacgggaagggcaccaa
tcagaggttctactcagcattgccgacgagtttcctcctgaccggtgcttcacccttgtg
tttcgtggacgaagaggcaacttggacctagtggccgaatccacaaaggaggcacaatca
tggataaaagggatacgcaaactcatcgataacctagagaacatggggcagagagagaaa
ctggaccaatggatctgtgactggtttaaaaaggcagacaaaaaccgagacggacggatg
aactttaaggaggtcagagatctgttgaagatgatgaacgtggacatgaacgagcaccac
gctctccgtctcttcacgatggcggatcggtctcagtcgggaacactcgaggatgatgag
tttgtgttgttttataagatgctgactcagcgcgaggacatcctgcgagtgtttcaggaa
tattcagccgatggacagaagctaacgctcaaagatctgaaagatttcttgcaggaggaa
cagttacatgaggacggagttcaacaatacgcacttaatctcattgaacgctttgaacca
tctgacacggcgaaaatgttacaagcaatgacgtttgatggtttcctaatgtacctgagc
tcatcagagggctccatcttcaaccctgcaatgctcgaactctaccaagacatgtctcag
cctctctgccattatttcatatcatcttctcataacacatacctactggaggaccaaatc
agaggacttagcagtgtggaaggctatatacgagcactgaaacgtggctgtcgatgtgtg
gaagtggactgttgggatggaccaaatggagagccaattgtctatcatgggcacacattc
acatccaagatcttcttcaaggatgttgtcactgtgctgggcaactattcttttaaagca
tcagagtaccctgtcatcctgtccattgagaaccactgcagtgtagagcagcagaaaatc
atggcccaacacctcacccagatcctgggagacaagctgctgaaaagcactttagatgga
aagattcccctcggcctcccgtcccctgaggatctgaaagggaagattctgttgaaagga
aagaagataggtggattagaggatggcatgaatggagtagtggatgaccctttgatggga
gaggtgagcgacgaagaggaggccactgaaattgaggatgaaaatcatcgcaacaacagc
atacgacacagaagcaagaaatccaaacagcggctgtctaaagagctgtccgactgtgtg
gtttactgcaagagtgtccactttagcagctttaaacattcacgaaatcactccaagttt
tacgagatctcctccttcacggagtctaaggcccggaagcacataagggaggcaggagca
gagtttgttcttcataatgcccgtcagttgagtcgggtttaccctagtggtttgagaacc
gactcctccaactttaacccacaggacttgtggaatgcagggtgccaaattgttgctcta
aactttcagacagcaggggttgagatggacctaaatgacggcttattcaatcaaaatgga
cgttgtggctacgtattaaaaccagcgttcatgcgcaactttgaagagatgtttgacccc
gaaaaccctcaaaatcgagaagattacaagccacttagcctgtccatacaggtgatcagc
ggccaacagcttccaaaagtaaacatcaaggagggctcaatcattgaccccttcgttcga
gtggagattcatggcgtaccactggatcaggccaagcaggaaaccagatacattgacaac
aacggttttaacccggtatggtacgacacccttcaattcaccattcacgctcctgaattg
gcactggtgcggtttgtcgtagaagactatgataaaacctcaaagaacgactttgtggga
cagttcactctccctttcacctgtattcaaccaggatatcgtcacattcatctgctttct
aaggatggcaccagcatacctccttcctcgctttttgttcatatccggattacaaactta
acctga

DBGET integrated database retrieval system