KEGG   Danio rerio (zebrafish): 565669Help
Entry
565669            CDS       T01004                                 

Gene name
plcd4a, si:dkeyp-84a8.7
Definition
(RefSeq) phospholipase C, delta 4a
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    565669 (plcd4a)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    565669 (plcd4a)
   04070 Phosphatidylinositol signaling system
    565669 (plcd4a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    565669 (plcd4a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     565669 (plcd4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 761 aa AA seqDB search
MTERQMASTERSLRIQADDDLKSMIVGTVMRKIKSRTWKKQRYFRLQEDCMTIWYQSKKA
GNAHSTFSVGDVEAVREGHQSEVLLSIADEFPPDRCFTLVFRGRRGNLDLVAESTKEAQS
WIKGIRKLIDNLENMGQREKLDQWICDWFKKADKNRDGRMNFKEVRDLLKMMNVDMNEHH
ALRLFTMADRSQSGTLEDDEFVLFYKMLTQREDILRVFQEYSADGQKLTLKDLKDFLQEE
QLHEDGVQQYALNLIERFEPSDTAKMLQAMTFDGFLMYLSSSEGSIFNPAMLELYQDMSQ
PLCHYFISSSHNTYLLEDQIRGLSSVEGYIRALKRGCRCVEVDCWDGPNGEPIVYHGHTF
TSKIFFKDVVTVLGNYSFKASEYPVILSIENHCSVEQQKIMAQHLTQILGDKLLKSTLDG
KIPLGLPSPEDLKGKILLKGKKIGGLEDGMNGVVDDPLMGEVSDEEEATEIEDENHRNNS
IRHRSKKSKQRLSKELSDCVVYCKSVHFSSFKHSRNHSKFYEISSFTESKARKHIREAGA
EFVLHNARQLSRVYPSGLRTDSSNFNPQDLWNAGCQIVALNFQTAGVEMDLNDGLFNQNG
RCGYVLKPAFMRNFEEMFDPENPQNREDYKPLSLSIQVISGQQLPKVNIKEGSIIDPFVR
VEIHGVPLDQAKQETRYIDNNGFNPVWYDTLQFTIHAPELALVRFVVEDYDKTSKNDFVG
QFTLPFTCIQPGYRHIHLLSKDGTSIPPSSLFVHIRITNLT
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgacagatggcttctactgaaaggagcctacgtatccaggctgatgatgac
ctgaagtccatgattgttggcacagtgatgagaaaaatcaagtctcgcacatggaaaaag
cagcgttacttcaggctacaagaagactgcatgactatctggtaccagagcaagaaagca
ggaaatgcccactccaccttttctgtgggtgatgttgaggctgtacgggaagggcaccaa
tcagaggttctactcagcattgccgacgagtttcctcctgaccggtgcttcacccttgtg
tttcgtggacgaagaggcaacttggacctagtggccgaatccacaaaggaggcacaatca
tggataaaagggatacgcaaactcatcgataacctagagaacatggggcagagagagaaa
ctggaccaatggatctgtgactggtttaaaaaggcagacaaaaaccgagacggacggatg
aactttaaggaggtcagagatctgttgaagatgatgaacgtggacatgaacgagcaccac
gctctccgtctcttcacgatggcggatcggtctcagtcgggaacactcgaggatgatgag
tttgtgttgttttataagatgctgactcagcgcgaggacatcctgcgagtgtttcaggaa
tattcagccgatggacagaagctaacgctcaaagatctgaaagatttcttgcaggaggaa
cagttacatgaggacggagttcaacaatacgcacttaatctcattgaacgctttgaacca
tctgacacggcgaaaatgttacaagcaatgacgtttgatggtttcctaatgtacctgagc
tcatcagagggctccatcttcaaccctgcaatgctcgaactctaccaagacatgtctcag
cctctctgccattatttcatatcatcttctcataacacatacctactggaggaccaaatc
agaggacttagcagtgtggaaggctatatacgagcactgaaacgtggctgtcgatgtgtg
gaagtggactgttgggatggaccaaatggagagccaattgtctatcatgggcacacattc
acatccaagatcttcttcaaggatgttgtcactgtgctgggcaactattcttttaaagca
tcagagtaccctgtcatcctgtccattgagaaccactgcagtgtagagcagcagaaaatc
atggcccaacacctcacccagatcctgggagacaagctgctgaaaagcactttagatgga
aagattcccctcggcctcccgtcccctgaggatctgaaagggaagattctgttgaaagga
aagaagataggtggattagaggatggcatgaatggagtagtggatgaccctttgatggga
gaggtgagcgacgaagaggaggccactgaaattgaggatgaaaatcatcgcaacaacagc
atacgacacagaagcaagaaatccaaacagcggctgtctaaagagctgtccgactgtgtg
gtttactgcaagagtgtccactttagcagctttaaacattcacgaaatcactccaagttt
tacgagatctcctccttcacggagtctaaggcccggaagcacataagggaggcaggagca
gagtttgttcttcataatgcccgtcagttgagtcgggtttaccctagtggtttgagaacc
gactcctccaactttaacccacaggacttgtggaatgcagggtgccaaattgttgctcta
aactttcagacagcaggggttgagatggacctaaatgacggcttattcaatcaaaatgga
cgttgtggctacgtattaaaaccagcgttcatgcgcaactttgaagagatgtttgacccc
gaaaaccctcaaaatcgagaagattacaagccacttagcctgtccatacaggtgatcagc
ggccaacagcttccaaaagtaaacatcaaggagggctcaatcattgaccccttcgttcga
gtggagattcatggcgtaccactggatcaggccaagcaggaaaccagatacattgacaac
aacggttttaacccggtatggtacgacacccttcaattcaccattcacgctcctgaattg
gcactggtgcggtttgtcgtagaagactatgataaaacctcaaagaacgactttgtggga
cagttcactctccctttcacctgtattcaaccaggatatcgtcacattcatctgctttct
aaggatggcaccagcatacctccttcctcgctttttgttcatatccggattacaaactta
acctga

DBGET integrated database retrieval system