KEGG   Danio rerio (zebrafish): 565669Help
Entry
565669            CDS       T01004                                 

Gene name
plcd4a, si:dkeyp-84a8.7
Definition
phospholipase C, delta 4a
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dre00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:dre04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dre04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 761 aa AA seqDB search
MTERQMASTERSLRIQADDDLKSMIVGTVMRKIKSRTWKKQRYFRLQEDCMTIWYQSKKA
GNAHSTFSVGDVEAVREGHQSEVLLSIADEFPPDRCFTLVFRGRRGNLDLVAESTKEAQS
WIKGIRKLIDNLENMGQREKLDQWICDWFKKADKNRDGRMNFKEVRDLLKMMNVDMNEHH
ALRLFTMADRSQSGTLEDDEFVLFYKMLTQREDILRVFQEYSADGQKLTLKDLKDFLQEE
QLHEDGVQQYALNLIERFEPSDTAKMLQAMTFDGFLMYLSSSEGSIFNPAMLELYQDMSQ
PLCHYFISSSHNTYLLEDQIRGLSSVEGYIRALKRGCRCVEVDCWDGPNGEPIVYHGHTF
TSKIFFKDVVTVLGNYSFKASEYPVILSIENHCSVEQQKIMAQHLTQILGDKLLKSTLDG
KIPLGLPSPEDLKGKILLKGKKIGGLEDGMNGVVDDPLMGEVSDEEEATEIEDENHRNNS
IRHRSKKSKQRLSKELSDCVVYCKSVHFSSFKHSRNHSKFYEISSFTESKARKHIREAGA
EFVLHNARQLSRVYPSGLRTDSSNFNPQDLWNAGCQIVALNFQTAGVEMDLNDGLFNQNG
RCGYVLKPAFMRNFEEMFDPENPQNREDYKPLSLSIQVISGQQLPKVNIKEGSIIDPFVR
VEIHGVPLDQAKQETRYIDNNGFNPVWYDTLQFTIHAPELALVRFVVEDYDKTSKNDFVG
QFTLPFTCIQPGYRHIHLLSKDGTSIPPSSLFVHIRITNLT
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgacagatggcttctactgaaaggagcctacgtatccaggctgatgatgac
ctgaagtccatgattgttggcacagtgatgagaaaaatcaagtctcgcacatggaaaaag
cagcgttacttcaggctacaagaagactgcatgactatctggtaccagagcaagaaagca
ggaaatgcccactccaccttttctgtgggtgatgttgaggctgtacgggaagggcaccaa
tcagaggttctactcagcattgccgacgagtttcctcctgaccggtgcttcacccttgtg
tttcgtggacgaagaggcaacttggacctagtggccgaatccacaaaggaggcacaatca
tggataaaagggatacgcaaactcatcgataacctagagaacatggggcagagagagaaa
ctggaccaatggatctgtgactggtttaaaaaggcagacaaaaaccgagacggacggatg
aactttaaggaggtcagagatctgttgaagatgatgaacgtggacatgaacgagcaccac
gctctccgtctcttcacgatggcggatcggtctcagtcgggaacactcgaggatgatgag
tttgtgttgttttataagatgctgactcagcgcgaggacatcctgcgagtgtttcaggaa
tattcagccgatggacagaagctaacgctcaaagatctgaaagatttcttgcaggaggaa
cagttacatgaggacggagttcaacaatacgcacttaatctcattgaacgctttgaacca
tctgacacggcgaaaatgttacaagcaatgacgtttgatggtttcctaatgtacctgagc
tcatcagagggctccatcttcaaccctgcaatgctcgaactctaccaagacatgtctcag
cctctctgccattatttcatatcatcttctcataacacatacctactggaggaccaaatc
agaggacttagcagtgtggaaggctatatacgagcactgaaacgtggctgtcgatgtgtg
gaagtggactgttgggatggaccaaatggagagccaattgtctatcatgggcacacattc
acatccaagatcttcttcaaggatgttgtcactgtgctgggcaactattcttttaaagca
tcagagtaccctgtcatcctgtccattgagaaccactgcagtgtagagcagcagaaaatc
atggcccaacacctcacccagatcctgggagacaagctgctgaaaagcactttagatgga
aagattcccctcggcctcccgtcccctgaggatctgaaagggaagattctgttgaaagga
aagaagataggtggattagaggatggcatgaatggagtagtggatgaccctttgatggga
gaggtgagcgacgaagaggaggccactgaaattgaggatgaaaatcatcgcaacaacagc
atacgacacagaagcaagaaatccaaacagcggctgtctaaagagctgtccgactgtgtg
gtttactgcaagagtgtccactttagcagctttaaacattcacgaaatcactccaagttt
tacgagatctcctccttcacggagtctaaggcccggaagcacataagggaggcaggagca
gagtttgttcttcataatgcccgtcagttgagtcgggtttaccctagtggtttgagaacc
gactcctccaactttaacccacaggacttgtggaatgcagggtgccaaattgttgctcta
aactttcagacagcaggggttgagatggacctaaatgacggcttattcaatcaaaatgga
cgttgtggctacgtattaaaaccagcgttcatgcgcaactttgaagagatgtttgacccc
gaaaaccctcaaaatcgagaagattacaagccacttagcctgtccatacaggtgatcagc
ggccaacagcttccaaaagtaaacatcaaggagggctcaatcattgaccccttcgttcga
gtggagattcatggcgtaccactggatcaggccaagcaggaaaccagatacattgacaac
aacggttttaacccggtatggtacgacacccttcaattcaccattcacgctcctgaattg
gcactggtgcggtttgtcgtagaagactatgataaaacctcaaagaacgactttgtggga
cagttcactctccctttcacctgtattcaaccaggatatcgtcacattcatctgctttct
aaggatggcaccagcatacctccttcctcgctttttgttcatatccggattacaaactta
acctga

DBGET integrated database retrieval system