KEGG   Danio rerio (zebrafish): 565736Help
Entry
565736            CDS       T01004                                 

Gene name
usp12a, sb:eu882, usp12, wu:fi09d12
Definition
ubiquitin specific peptidase 12a (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 371 aa AA seqDB search
MEILMTVSKFASFCTMGANASALEKEIGSEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKILAYRSQPRRKENLLTCLADLFHSIANQKRKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADLLQEERKQDKQNGKLANGTLDSQNNNSTPPSTTWVHEIFQGT
LTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSK
QEAHKRMRVKKLPMILALHLKRFKYMEQLQRYTKLSYRVVFPLELRLFNTSGDATNPERL
YDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSEISKNSE
SGYILFYQSRD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtttccaaatttgcctctttttgtaccatgggcgccaatgcc
tccgctttggagaaagagatcggctcggagcagttcccagtcaacgagcattacttcgga
ttggtcaacttcggaaacacctgctactgtaactctgtgctccaggctctgtacttctgc
cggccgtttcgggagaagatccttgcgtacaggagtcaaccgcgccgcaaggagaacctg
ctcacctgcctggctgacctgttccacagtatagccaaccagaagaggaaagttggcgtt
ataccgccgaagaagttcattacgcgactacggaaagagaatgaactgtttgataactac
atgcagcaagatgcacatgagtttctcaactacctgctgaacactatagcagatctgctc
caagaagagcgcaaacaagacaagcagaatggcaagcttgccaacggcacactcgattcc
cagaacaataacagcaccccaccctccaccacctgggttcatgagatcttccagggcacg
ttgaccaatgagacgcgatgcctcacctgcgaaacgataagcagcaaagatgaggatttc
ttggatttgtcagtggacgtggagcagaacacttcaatcacacactgtctcagaggtttc
agtaatacagagacgttgtgcagtgaatataaatattactgtgaggaatgcagaagtaaa
caggaggcacacaaacgaatgcgggttaagaaacttcccatgatcctcgccttgcacttg
aagagatttaaatacatggagcagctgcagcgctacactaagctaagctaccgtgtggtc
ttccctctggagctccgcctctttaacacctctggtgacgccaccaatcccgagaggctt
tacgacctggtcgctgtggtggtgcattgtggcagtggtccaaaccgaggacactacatc
gcaattgtaaaaagtcatgatttctggctactgtttgatgacgacattgtagagaaaatc
gatgcccaggcgattgaagagttctacggattaacctcggaaatttccaagaactctgag
tctggctacatcctgttttaccagtccagagactga

DBGET integrated database retrieval system