KEGG   Danio rerio (zebrafish): 565830Help
Entry
565830            CDS       T01004                                 

Gene name
mapk6, erk3, p97mapk, si:ch211-235f12.1
Definition
mitogen-activated protein kinase 6 (EC:2.7.1.-)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     565830 (mapk6)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   565830 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18
AA seq 729 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVSSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEDHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRLELQSVIPVFIKNDMSEPHTPLAKLLPGVSPEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSLHPFHIEDEVDDILLMDESHSHVYNWDRYHES
QFSDQDWHLHSTHELEDVQRDPRAMSDVTDEEEVQIDPRKYMDGDCEKFLEDPSFDLPPE
HLWQLEDHHENKYCDQECSYTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKEQ
QSKEKIDKKGKSKCEKNGLVKAQIALKEASQNHTVPEKDRDQEKHQNHNQGFDFDSFIAS
TIKLSLQPESGDVDLLNELNTSVSQLDTRAPCGSMSKSISQEKEEKCLVNLAQLGVRAPC
PWESFTDCGVAESSLIDQACWDVRKDEQLQKENSSCQSSYLDRLFNKRDDVEPEILEPVE
VVSTTESDFISCSGEIVFNMQLESLAIPGFEGAADIPLKSIQATLAPSAVKHSPQIAHKT
YSSIFKHLN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagccttatgaacattcatggcttcgatctggggcctcgctac
atggacctgaagccacttggctacggtggcaacggcttggtgttttccgctgttgatacc
gattgtgacaagagggttgctgttaaaaagattgtcttgactgacccacagagtgtcaaa
catgcgctgcgtgaaatcaaaatcatccgcaggcttgatcatgacaacatcgtgaaggtg
ttcgaaactctggggcccagtggccggaggctcacggaggacgtgagctctctgacagag
gtcaattcagtgtacatcgtccaggagtacatggaaactgacctctgtaaagtactggaa
cagggcttgttgtctgaggatcacgcacggctgttcatgtaccaactgctccggggactc
aaatacatccactctgcaaacgtgcttcatcgtgacctgaagcctgccaacctctttgtc
aacactgaggacttggttctaaaaattggagactttggactcgcccggatcatggacccc
cactattcccataagggccatctgtctgaaggactggtcactaaatggtatcgttctcct
cgtctgcttctatcccccaataactacaccaaagccattgacatgtgggccgctgggtgc
atctttgccgaaatgctgactggaaaaacactctttgcaggagctcacgagttggaacag
atgcagctgattttggaatccattcccgtagtccatgaggaagaccgactggaactccaa
agcgttatacccgtcttcatcaagaacgacatgtcagaaccacacacgccccttgccaag
ttgctacctggtgtcagccctgaggccttggatttcctggagaagatcttgacatttaac
ccaatggaccgtctcactgcagaagaggctcttgctcatccatacatgagcgactattca
ttccctctagacgaaccagtgtccttgcaccccttccacattgaggatgaggtggatgac
atccttctcatggatgagagtcacagtcacgtctacaactgggacaggtatcatgaaagt
cagttctctgatcaagactggcatctgcacagcacccatgagctggaagatgtgcagcgt
gatcctcgagctatgtcagatgtgactgatgaggaggaggtccagatcgacccccggaaa
tacatggatggagattgcgagaagttcctcgaagatccatcattcgacctcccaccagag
cacttgtggcagctggaagatcaccacgagaacaagtactgtgaccaggagtgcagctac
acatgcaactataaagctgtatccccatcctacctggacaatctgatctggagggacagt
gaggtgaaccactactacgagcccaaactcatcatcgacctctccaactggaaagagcaa
cagagcaaagaaaagattgacaaaaagggcaagagcaagtgtgagaagaacggactggtc
aaggctcagatcgctctgaaggaggcatctcagaaccacacggtgcccgagaaggatcgc
gatcaggaaaaacaccagaatcacaaccagggctttgacttcgactcgtttatcgctagc
accatcaaactgagcctgcagccggaatctggcgacgttgacctcctgaacgagttgaac
acctccgtttcacagctggacactcgcgctccttgtggctccatgtccaaatccatcagt
caggaaaaagaagagaagtgcctagtcaacctggcacagctcggcgtccgggctccgtgc
ccttgggagagtttcacggactgtggtgttgccgagagcagcctgatcgaccaggcttgc
tgggacgtccgtaaagacgagcagctgcaaaaggaaaacagcagctgccagagcagttac
ctggaccgtctcttcaacaagcgtgacgatgtggagcctgagatcctcgagcctgtggag
gtggtgtccaccacggagagtgacttcatatcctgtagcggagagattgtctttaacatg
caactggaatctctggccattccagggttcgagggagcggctgacattcctctgaagtcc
atccaggccacgttagcgccatccgctgttaaacactccccacaaatcgcccataagacc
tacagcagcattttcaagcatttaaattga

DBGET integrated database retrieval system