KEGG   Danio rerio (zebrafish): 566841Help
Entry
566841            CDS       T01004                                 

Gene name
crebbpa, cbp-b, crebbp, si:dkey-206l1.6, si:dkey-44g23.1
Definition
CREB binding protein a
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    566841 (crebbpa)
   04330 Notch signaling pathway
    566841 (crebbpa)
   04350 TGF-beta signaling pathway
    566841 (crebbpa)
   04630 Jak-STAT signaling pathway
    566841 (crebbpa)
   04068 FoxO signaling pathway
    566841 (crebbpa)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    566841 (crebbpa)
  Cellular commiunity
   04520 Adherens junction
    566841 (crebbpa)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    566841 (crebbpa)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    566841 (crebbpa)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     566841 (crebbpa)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    566841 (crebbpa)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    566841 (crebbpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 2350 aa AA seqDB search
MAENVLDVGPPNAKRAKLTAPAPDAPELGSLSWDDLENDLPDELIPNGDLGLMSLPSNGG
AAGTGAHGPMVPDAAAKHKQLSELLRPGSSAGMNSVSPQPGGIGPQLGGLGKSPLGQGSP
SHPSQTQKPGGTPGTQGNNAGSAGMGFNQGMLNSGMMGQNAGAQGGQVINGALGTVGRGR
GVQGMYQGAAMQVASSVGAGGGVGAAAPGGAGSVLAETLTQGAQQMGINAQQAKMGMAGG
NSPFGQYQAGGQQLGTNAQNKGALPNSLPPFPTDLKGATVTSVPNMPQQQQVSVGMVAGQ
GVSTGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGDVRACALPHCRTMKNVLNHMTHC
QAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASENANKHNQQPMLSPPNASLQT
PIGSVGTGQQTAPALPSSTPIDPSSMRRAYAALGLPYSNQNPTQTQSPTQTQGPGQTTAQ
TPHQQPMRSINALGGGQLNPIGVPTSEQAKLLPDGTMPSTLNNPVMPDGSTVGNLSNLPT
AAPLSATGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGD
MYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQTSMTATGQQPSALNQPNVM
GPRPQNGPVPMPNVPNQILNRMQVSQGMNPFSAMSNVPMSQAPMGTRAASPINHQQINMN
QVPTMNMSPTRIAPTQGMLGAHGGNMVTQTPNQTQFMTQPPFPATTNTMNVNMGQPNSQT
PVSQQQPNANLPLNALGPLGPALGCPTPPQAPLRATPPPNATAASTTNLPAALQPSTPTP
APAQATPPHMQTQAELPIPGQQHPGTPTGENRVPTPASAASTELHSQHAVPDVPPNDTKT
EEQDYDMAVKTEPSTETEEDTGSLLVKKEEQEGSEAKQEPMETEDKKTDLKTETKEEDES
KTNGTASSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFD
IVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQ
EIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPRDGTYYSYQNRYHFCEKCFNEIQGD
SVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFI
CDNCLKKSAKSRKENKFTAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDK
TVEVKPGMKAKFVDTGEMMEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTR
RVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTAHIWACPPSEGDDYIFHCH
PADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPN
VLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNAKKKNNKKTNKNKSSLSRANKKK
PGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPIVNSLLPILDSDPLLNCDLMDGRDAF
LTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFD
LCINCYNAKGHEHQMVKWGLGLDDDSSSQSGEASKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQLQHRLQQAQMMRRRMATMQGRAMPQSLPSPPASTAPSTPTSHQQPNTPQTPQP
LPNQPTTPNAVVMSPTYPNTPRNGQPLPQASQGKPGPQASPLHQQQSPLPQPPQQQPPPQ
QPPQQQQQPPPMAVKMARHIEMVAQAQQNYRMTMNGLPMNHQQPRMPGAMQPPMQLVGPR
GQQVMQPMPQGQWPGGAQPSMPAAQQQVAQQTPQGPQSTLPIQRPAMPQQVAQPRMMVPT
QGPRPQAPQRAAGIAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKY
HASQPQQQQPQQGIHAAQPAMQNMAAMQAVPRPGMAPQQQQQQPTPQGMAALGPQGQLMN
PAPANNPQLQEMYRRQLLRHQQQQQQQQQQGGMPQAHGQFPQAQGTATNYTQLRMQQQQL
AMQGTGGPMGQLPPMAQMAMDGTPNLLHQRNNLLLQQQQLPQQQVVLKPPMGSQAQPSPM
SPQTHLLSGQPQGAHLPGQPMANALSNQVCSPGPVQSPRPPSQQPPPHSSPSPHVQPQPS
PQHVPSHTGSPHPGLTTPMPGSMDQGHLGTPEQSAMLPQLNTPNRGGLPSDLNMVGDTTG
DTLEKFVEGL
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatgtgctcgacgtcggccctcccaatgcgaagcgggcgaagctgacagca
cctgctccagacgcaccagagttgggttcactttcatgggatgacctggagaacgatctt
ccagatgagctgattcctaacggagacctggggctgatgtccttgccctcaaacggcggg
gctgcaggtacgggcgctcacggccccatggtccccgacgccgctgccaagcacaagcaa
ctctcggaactcctgcggccgggaagcagcgctggcatgaactctgtcagcccacagcct
ggcggcatcggacctcagcttggtgggctcggaaagagtcccctaggccaaggctcccct
tcccacccttcccaaacacaaaaaccagggggcactcctgggacgcagggcaataacgcc
ggatcagctggcatgggatttaaccagggtatgctgaacagcggcatgatgggacagaat
gctggtgctcaaggaggtcaggtgatcaatggagctcttgggactgtaggccgcggtcga
ggcgtgcagggaatgtaccagggtgctgccatgcaggttgcatcttctgttggagcggga
ggaggagtgggggcggcggcacctggaggagcaggaagtgtcctagcggaaacgctcaca
caaggggcacagcagatgggcatcaacgctcagcaggccaagatgggcatggcaggtggc
aacagtccatttgggcagtaccaggctggaggtcaacaactgggcacgaacgcacagaat
aaaggcgcccttcccaacagcctccccccatttccaactgacctaaagggggcgactgtc
accagcgtgccaaacatgccccagcagcagcaggtgtcggtgggcatggtggcgggtcag
ggcgtatcgacgggtcccacggctgacccggagaagcgtaaactgatccagcagcagctg
gttctgctgcttcatgcccacaagtgccagcggcgcgagcaggccaacggagatgtgcga
gcatgtgctctgccacactgcaggaccatgaagaacgtcctcaaccacatgacgcactgc
caggctggcaagtcctgccaagtggctcactgtgcttcatcgaggcagatcatctcgcac
tggaagaactgcaccagacatgactgtcctgtctgcctgcccctgaagaacgccagcgaa
aacgctaataaacacaaccagcaaccaatgctgagtcccccaaacgctagtctacaaacc
cccattgggtctgtcggcacggggcagcagactgcgcccgctctgcccagctccacaccc
atcgacccaagctccatgcggcgggcgtatgctgccctcggcctcccctacagcaatcag
aaccccacacagacccagtcccccacgcagacacagggccccggacagacaacggcacag
acaccacaccagcagccaatgagatccatcaatgcacttggaggaggtcagttgaaccca
atcggcgtaccgacatccgaacaggctaagctgctcccagatggcaccatgccatcaacc
cttaacaatccggtgatgccagacggctctacagtaggcaatctgagtaacctgcccact
gcggcccctctgtcagccaccggtgtgaggaaagcctggcatgagcacgtcactcaggac
ctccgcaatcaccttgtacacaaactggttcaggccatcttccccacaccagaccctgct
gccctgaaggaccgacgaatggagaacttggtggcgtacgcacgaaaagtggaaggggac
atgtacgagtccgccaacagcagggacgagtactatcactttctggcagagaagatctat
aagatccagaaagagctggaagagaagagaaggtcacggttgcagaagcagatcatcaac
cagacgtctatgactgcaacaggacagcagccatcagccctcaaccagcctaatgtcatg
ggaccgcggccacagaatggacccgtgcctatgcccaatgtgccaaatcagatcctgaat
cgcatgcaggtgtctcaagggatgaatccatttagtgcaatgtccaatgtgccgatgtct
caggctcccatgggaacacgtgccgcctctccgatcaaccatcaacagatcaacatgaac
caagtcccaacaatgaacatgtctccaacacgaattgctccaacgcaagggatgctagga
gctcacggagggaacatggtcacgcaaacgcccaaccagacgcagttcatgactcaacca
ccgtttcctgctaccaccaacaccatgaacgtcaacatgggccagcccaactcgcagaca
ccagtttcgcagcagcagccgaacgctaacctccccctgaatgcacttggccccttgggc
cctgcgctaggctgccccacgccccctcaggctccactgcgcgccacaccgccccccaac
gccaccgccgccagcaccactaacctgccagcagcactgcagccctccacacccaccccc
gcccctgcccaggccaccccgccgcacatgcagacccaggctgagctgcccatccctggc
cagcagcaccctggaacaccgactggtgaaaaccgtgtacccacgccagcgtcagcagcc
agcactgagctgcactcccagcatgctgtgcctgacgtaccacccaatgacactaaaaca
gaagagcaggattacgacatggccgtcaaaacagagcccagcacggagacagaggaagac
acaggctcactgctagtcaaaaaggaggagcaggagggctcggaggccaagcaggagcca
atggagacagaggacaagaagactgacttaaagacggagaccaaagaggaggatgaaagc
aagacaaacggcacagcgtcctcttcaccgtcacagtctcgcaggaaaatctttaagcca
gaagagttgcgacaggctttgatgcccaccttggagtctctgtacaggcaggatccagag
tctctgcctttccggcagcctgtggaccccatacttctaggcatccctgattattttgat
atcgtgaagaaccccatagacctgtccactatcaagcgtaagctggacacgggtcagtac
caggagccctggcagtacgtggatgatgtgtggctgatgttcaacaacgcctggctatac
aacaggaagacgtcacgcgtctacaagtactgctccaaattggcggaggtgtttgaacag
gagattgaccccgtcatgcagggactcgggtactgctgcgggcggaagtacgagttttct
cctcagacgctgtgctgttacggcaagcagctctgcacaataccccgagacggcacttac
tacagttatcagaacagatatcatttctgtgagaaatgcttcaatgagatccagggagac
agcgtgacgctaggagatgatcctgctcagcctcagaccatgatctctaaagaccagttt
gaaagaaagaagaacgacacattagatcctgagccgtttgttgaatgtaaagattgcggg
cggaagatgcatcagatttgtgtcctgcattatgaagtcatttggccttcaggtttcatc
tgcgataactgtttgaaaaagagtgcaaagtcaagaaaggaaaacaagtttacggcaaag
aggttgcagtcaacgaggttaggcacttacatagaggatcgagtgaacaagtacttgaag
aggcagaaccatccggaagctggagaggtgtttgtacgagtagtagccagttcagacaaa
acggtggaggtcaaacctggcatgaaggccaagtttgtggacacaggagagatgatggag
gccttcccctacagaaccaaagcacttttcgcctttgaggaaattgatggagtggatgtg
tgtttttttggcatgcacgtgcaagaatacggctctgattgccctttccctaacaccaga
cgggtatacatatcatacctcgatagtattcacttcttcaaacctcgcatgctgagaaca
gctgtctatcacgaaatcctcattggctatttagaatacgtcaagaagcttggatatgtt
acggcacacatctgggcatgtccgcctagtgagggtgatgactatatcttccattgtcac
cctgccgaccagaaaatcccaaaacctaagcgcctgcaggagtggtaccgcaaaatgttg
gacaaagcctttgctgagcggattctgcatgactacaaggacattttcaaacaagccaca
gaggaccgtttgacgagtgcaaacgagcttccatattttgagggggatttttggcccaat
gtattggaagagagcatcaaggagttagagcaagaggaagaagaaaggaaaaaagaagaa
aacacggcagcttgtgaaactccggagggcacaccaggagacagtaaaaatgcaaagaag
aagaacaacaagaaaacgaataagaataaaagcagcttgagccgagctaataaaaagaaa
cctgggatgccgaatgtagccaatgacctttctcagaagctctacgccaccatggagaaa
cacaaagaggtgttttttgtaattcatctgcattctgggcccatagtcaactccttatta
cccatccttgactctgatcccctgctgaactgtgacttgatggacggaagagacgccttt
ttgacattagcacgggataagcactgggagttcagctctttgcggcgctgcaagtggagc
accatgtgcatgctggtggaattgcacaaccagggccaggaccgctttgtctacacctgc
aacgaatgtaaacaccatgtcgagacacgctggcactgtacggtctgcgaggactttgac
ctgtgtattaattgctacaacgctaagggacatgagcaccagatggttaagtggggtctg
ggtctggatgatgacagcagtagccaaagtggtgaggcctccaagagtcctcaagagagc
cggcgtctaagcatccagcgttgcatccagtctctggtgcatgcctgccagtgccgcaac
gccaactgctctttgccatcttgccagaagatgaagcgtgtggtgcagcacaccaagggc
tgcaagcgcaagacaaacggtggctgtccggtgtgcaagcagctcattgctctctgctgc
tatcatgccaagcactgccaggagaacaagtgtcctgtgcccttctgcctcaatatcaag
cacaaactgcggcagcagcagctacaacaccggctgcagcaggcgcagatgatgcggaga
cgcatggccactatgcagggtcgagccatgcctcaaagcctaccgtcaccacccgcatcc
acagcccccagcacacccacctcgcatcagcaacccaacacgcctcaaacgccgcaaccg
ctgcccaatcagccgactacgccaaacgctgtcgtaatgtcaccaacctatcccaatacc
ccacgcaatggacaaccccttcctcaagcctcacagggcaaacccggcccacaggcgtcc
ccactacatcagcagcagtctccactcccacagccaccccagcagcagcctccgccgcaa
caacctccgcagcagcagcagcagcctccacctatggcagtcaagatggcacggcacata
gagatggtggcgcaggctcaacagaactatcgcatgaccatgaatggccttcccatgaac
caccagcagccgcgcatgccaggtgcaatgcaaccacccatgcagcttgttgggccacgc
gggcagcaggtcatgcagcccatgccgcaaggacagtggcctggaggcgctcagcctagt
atgccagcagctcagcagcaggtcgctcaacagaccccacagggccctcagtcgaccttg
cctatacagagacccgcaatgccccagcaagttgcccagccacgcatgatggtgcccacg
cagggccctcgaccgcaagcaccccagagagccgcaggcatcgctcctaatgccttacag
gatctgctacgcaccctcaagtcacccagctcaccccaacaacagcagcaagtgttgaac
atcctcaaatcgaacccgcaactcatggcagccttcatcaaacagagaactgcaaagtac
cacgccagccagccccagcagcagcagccacagcagggcatacacgcagcgcagccagcc
atgcagaacatggcagctatgcaggctgtgccacgacctggcatggcccctcagcagcaa
caacagcagcccacaccacaaggcatggcagctcttggtccacagggtcaactcatgaac
cctgcgcccgccaacaaccctcagttacaggaaatgtaccgacggcagcttctgcgacat
cagcagcagcagcagcaacaacagcagcagggagggatgcctcaagctcatggccagttc
ccacaggcacaaggaactgctaccaactacacgcaactccggatgcagcagcagcagttg
gccatgcagggaacaggtggacccatgggccagcttcccccaatggcccagatggctatg
gatggcacacccaaccttttgcaccagcgcaacaatctcctactacagcaacagcagctt
ccgcaacaacaggttgtcctcaagcctcccatgggctcacaggcacaaccgagccccatg
agcccacaaactcaccttctctcgggccagccgcagggcgcacacctacccggccaaccc
atggctaatgcactcagtaatcaggtgtgttcgccaggccccgtacaatcacccagacct
ccgtcacagcagcctcctccacattccagcccttccccacacgttcagcctcagccgtca
ccccaacatgtgccatcccatacggggtcaccacaccctggtctgacaacacccatgcct
ggctccatggatcaaggacatctgggtacgcccgagcagagtgccatgctcccgcagctc
aatacgcccaatcggggagggctgcccagtgacttaaacatggtgggagacacaacagga
gacaccctagagaaatttgtggagggattgtag

DBGET integrated database retrieval system