KEGG   Danio rerio (zebrafish): 566841Help
Entry
566841            CDS       T01004                                 

Gene name
crebbpa
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04068  FoxO signaling pathway
dre04110  Cell cycle
dre04310  Wnt signaling pathway
dre04330  Notch signaling pathway
dre04350  TGF-beta signaling pathway
dre04520  Adherens junction
dre04916  Melanogenesis
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    566841 (crebbpa)
   04330 Notch signaling pathway
    566841 (crebbpa)
   04350 TGF-beta signaling pathway
    566841 (crebbpa)
   04068 FoxO signaling pathway
    566841 (crebbpa)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    566841 (crebbpa)
  Cellular community - eukaryotes
   04520 Adherens junction
    566841 (crebbpa)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    566841 (crebbpa)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    566841 (crebbpa)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     566841 (crebbpa)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    566841 (crebbpa)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    566841 (crebbpa)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    566841 (crebbpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 566841
NCBI-ProteinID: XP_005161826
ZFIN: ZDB-GENE-050208-439
Ensembl: ENSDARG00000104609
Vega: OTTDARG00000010667
Position
22
AA seq 2350 aa AA seqDB search
MAENVLDVGPPNAKRAKLTAPAPDAPELGSLSWDDLENDLPDELIPNGDLGLMSLPSNGG
AAGTGAHGPMVPDAAAKHKQLSELLRPGSSAGMNSVSPQPGGIGPQLGGLGKSPLGQGSP
SHPSQTQKPGGTPGTQGNNAGSAGMGFNQGMLNSGMMGQNAGAQGGQVINGALGTVGRGR
GVQGMYQGAAMQVASSVGAGGGVGAAAPGGAGSVLAETLTQGAQQMGINAQQAKMGMAGG
NSPFGQYQAGGQQLGTNAQNKGALPNSLPPFPTDLKGATVTSVPNMPQQQQVSVGMVAGQ
GVSTGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGDVRACALPHCRTMKNVLNHMTHC
QAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASENANKHNQQPMLSPPNASLQT
PIGSVGTGQQTAPALPSSTPIDPSSMRRAYAALGLPYSNQNPTQTQSPTQTQGPGQTTAQ
TPHQQPMRSINALGGGQLNPIGVPTSEQAKLLPDGTMPSTLNNPVMPDGSTVGNLSNLPT
AAPLSATGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGD
MYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQTSMTATGQQPSALNQPNVM
GPRPQNGPVPMPNVPNQILNRMQVSQGMNPFSAMSNVPMSQAPMGTRAASPINHQQINMN
QVPTMNMSPTRIAPTQGMLGAHGGNMVTQTPNQTQFMTQPPFPATTNTMNVNMGQPNSQT
PVSQQQPNANLPLNALGPLGPALGCPTPPQAPLRATPPPNATAASTTNLPAALQPSTPTP
APAQATPPHMQTQAELPIPGQQHPGTPTGENRVPTPASAASTELHSQHAVPDVPPNDTKT
EEQDYDMAVKTEPSTETEEDTGSLLVKKEEQEGSEAKQEPMETEDKKTDLKTETKEEDES
KTNGTASSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFD
IVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQ
EIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPRDGTYYSYQNRYHFCEKCFNEIQGD
SVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFI
CDNCLKKSAKSRKENKFTAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDK
TVEVKPGMKAKFVDTGEMMEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTR
RVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTAHIWACPPSEGDDYIFHCH
PADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPN
VLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNAKKKNNKKTNKNKSSLSRANKKK
PGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPIVNSLLPILDSDPLLNCDLMDGRDAF
LTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFD
LCINCYNAKGHEHQMVKWGLGLDDDSSSQSGEASKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQLQHRLQQAQMMRRRMATMQGRAMPQSLPSPPASTAPSTPTSHQQPNTPQTPQP
LPNQPTTPNAVVMSPTYPNTPRNGQPLPQASQGKPGPQASPLHQQQSPLPQPPQQQPPPQ
QPPQQQQQPPPMAVKMARHIEMVAQAQQNYRMTMNGLPMNHQQPRMPGAMQPPMQLVGPR
GQQVMQPMPQGQWPGGAQPSMPAAQQQVAQQTPQGPQSTLPIQRPAMPQQVAQPRMMVPT
QGPRPQAPQRAAGIAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKY
HASQPQQQQPQQGIHAAQPAMQNMAAMQAVPRPGMAPQQQQQQPTPQGMAALGPQGQLMN
PAPANNPQLQEMYRRQLLRHQQQQQQQQQQGGMPQAHGQFPQAQGTATNYTQLRMQQQQL
AMQGTGGPMGQLPPMAQMAMDGTPNLLHQRNNLLLQQQQLPQQQVVLKPPMGSQAQPSPM
SPQTHLLSGQPQGAHLPGQPMANALSNQVCSPGPVQSPRPPSQQPPPHSSPSPHVQPQPS
PQHVPSHTGSPHPGLTTPMPGSMDQGHLGTPEQSAMLPQLNTPNRGGLPSDLNMVGDTTG
DTLEKFVEGL
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatgtgctcgacgtcggccctcccaatgcgaagcgggcgaagctgacagca
cctgctccagacgcaccagagttgggttcactttcatgggatgacctggagaacgatctt
ccagatgagctgattcctaacggagacctggggctgatgtccttgccctcaaacggcggg
gctgcaggtacgggcgctcacggccccatggtccccgacgccgctgccaagcacaagcaa
ctctcggaactcctgcggccgggaagcagcgctggcatgaactctgtcagcccacagcct
ggcggcatcggacctcagcttggtgggctcggaaagagtcccctaggccaaggctcccct
tcccacccttcccaaacacaaaaaccagggggcactcctgggacgcagggcaataacgcc
ggatcagctggcatgggatttaaccagggtatgctgaacagcggcatgatgggacagaat
gctggtgctcaaggaggtcaggtgatcaatggagctcttgggactgtaggccgcggtcga
ggcgtgcagggaatgtaccagggtgctgccatgcaggttgcatcttctgttggagcggga
ggaggagtgggggcggcggcacctggaggagcaggaagtgtcctagcggaaacgctcaca
caaggggcacagcagatgggcatcaacgctcagcaggccaagatgggcatggcaggtggc
aacagtccatttgggcagtaccaggctggaggtcaacaactgggcacgaacgcacagaat
aaaggcgcccttcccaacagcctccccccatttccaactgacctaaagggggcgactgtc
accagcgtgccaaacatgccccagcagcagcaggtgtcggtgggcatggtggcgggtcag
ggcgtatcgacgggtcccacggctgacccggagaagcgtaaactgatccagcagcagctg
gttctgctgcttcatgcccacaagtgccagcggcgcgagcaggccaacggagatgtgcga
gcatgtgctctgccacactgcaggaccatgaagaacgtcctcaaccacatgacgcactgc
caggctggcaagtcctgccaagtggctcactgtgcttcatcgaggcagatcatctcgcac
tggaagaactgcaccagacatgactgtcctgtctgcctgcccctgaagaacgccagcgaa
aacgctaataaacacaaccagcaaccaatgctgagtcccccaaacgctagtctacaaacc
cccattgggtctgtcggcacggggcagcagactgcgcccgctctgcccagctccacaccc
atcgacccaagctccatgcggcgggcgtatgctgccctcggcctcccctacagcaatcag
aaccccacacagacccagtcccccacgcagacacagggccccggacagacaacggcacag
acaccacaccagcagccaatgagatccatcaatgcacttggaggaggtcagttgaaccca
atcggcgtaccgacatccgaacaggctaagctgctcccagatggcaccatgccatcaacc
cttaacaatccggtgatgccagacggctctacagtaggcaatctgagtaacctgcccact
gcggcccctctgtcagccaccggtgtgaggaaagcctggcatgagcacgtcactcaggac
ctccgcaatcaccttgtacacaaactggttcaggccatcttccccacaccagaccctgct
gccctgaaggaccgacgaatggagaacttggtggcgtacgcacgaaaagtggaaggggac
atgtacgagtccgccaacagcagggacgagtactatcactttctggcagagaagatctat
aagatccagaaagagctggaagagaagagaaggtcacggttgcagaagcagatcatcaac
cagacgtctatgactgcaacaggacagcagccatcagccctcaaccagcctaatgtcatg
ggaccgcggccacagaatggacccgtgcctatgcccaatgtgccaaatcagatcctgaat
cgcatgcaggtgtctcaagggatgaatccatttagtgcaatgtccaatgtgccgatgtct
caggctcccatgggaacacgtgccgcctctccgatcaaccatcaacagatcaacatgaac
caagtcccaacaatgaacatgtctccaacacgaattgctccaacgcaagggatgctagga
gctcacggagggaacatggtcacgcaaacgcccaaccagacgcagttcatgactcaacca
ccgtttcctgctaccaccaacaccatgaacgtcaacatgggccagcccaactcgcagaca
ccagtttcgcagcagcagccgaacgctaacctccccctgaatgcacttggccccttgggc
cctgcgctaggctgccccacgccccctcaggctccactgcgcgccacaccgccccccaac
gccaccgccgccagcaccactaacctgccagcagcactgcagccctccacacccaccccc
gcccctgcccaggccaccccgccgcacatgcagacccaggctgagctgcccatccctggc
cagcagcaccctggaacaccgactggtgaaaaccgtgtacccacgccagcgtcagcagcc
agcactgagctgcactcccagcatgctgtgcctgacgtaccacccaatgacactaaaaca
gaagagcaggattacgacatggccgtcaaaacagagcccagcacggagacagaggaagac
acaggctcactgctagtcaaaaaggaggagcaggagggctcggaggccaagcaggagcca
atggagacagaggacaagaagactgacttaaagacggagaccaaagaggaggatgaaagc
aagacaaacggcacagcgtcctcttcaccgtcacagtctcgcaggaaaatctttaagcca
gaagagttgcgacaggctttgatgcccaccttggagtctctgtacaggcaggatccagag
tctctgcctttccggcagcctgtggaccccatacttctaggcatccctgattattttgat
atcgtgaagaaccccatagacctgtccactatcaagcgtaagctggacacgggtcagtac
caggagccctggcagtacgtggatgatgtgtggctgatgttcaacaacgcctggctatac
aacaggaagacgtcacgcgtctacaagtactgctccaaattggcggaggtgtttgaacag
gagattgaccccgtcatgcagggactcgggtactgctgcgggcggaagtacgagttttct
cctcagacgctgtgctgttacggcaagcagctctgcacaataccccgagacggcacttac
tacagttatcagaacagatatcatttctgtgagaaatgcttcaatgagatccagggagac
agcgtgacgctaggagatgatcctgctcagcctcagaccatgatctctaaagaccagttt
gaaagaaagaagaacgacacattagatcctgagccgtttgttgaatgtaaagattgcggg
cggaagatgcatcagatttgtgtcctgcattatgaagtcatttggccttcaggtttcatc
tgcgataactgtttgaaaaagagtgcaaagtcaagaaaggaaaacaagtttacggcaaag
aggttgcagtcaacgaggttaggcacttacatagaggatcgagtgaacaagtacttgaag
aggcagaaccatccggaagctggagaggtgtttgtacgagtagtagccagttcagacaaa
acggtggaggtcaaacctggcatgaaggccaagtttgtggacacaggagagatgatggag
gccttcccctacagaaccaaagcacttttcgcctttgaggaaattgatggagtggatgtg
tgtttttttggcatgcacgtgcaagaatacggctctgattgccctttccctaacaccaga
cgggtatacatatcatacctcgatagtattcacttcttcaaacctcgcatgctgagaaca
gctgtctatcacgaaatcctcattggctatttagaatacgtcaagaagcttggatatgtt
acggcacacatctgggcatgtccgcctagtgagggtgatgactatatcttccattgtcac
cctgccgaccagaaaatcccaaaacctaagcgcctgcaggagtggtaccgcaaaatgttg
gacaaagcctttgctgagcggattctgcatgactacaaggacattttcaaacaagccaca
gaggaccgtttgacgagtgcaaacgagcttccatattttgagggggatttttggcccaat
gtattggaagagagcatcaaggagttagagcaagaggaagaagaaaggaaaaaagaagaa
aacacggcagcttgtgaaactccggagggcacaccaggagacagtaaaaatgcaaagaag
aagaacaacaagaaaacgaataagaataaaagcagcttgagccgagctaataaaaagaaa
cctgggatgccgaatgtagccaatgacctttctcagaagctctacgccaccatggagaaa
cacaaagaggtgttttttgtaattcatctgcattctgggcccatagtcaactccttatta
cccatccttgactctgatcccctgctgaactgtgacttgatggacggaagagacgccttt
ttgacattagcacgggataagcactgggagttcagctctttgcggcgctgcaagtggagc
accatgtgcatgctggtggaattgcacaaccagggccaggaccgctttgtctacacctgc
aacgaatgtaaacaccatgtcgagacacgctggcactgtacggtctgcgaggactttgac
ctgtgtattaattgctacaacgctaagggacatgagcaccagatggttaagtggggtctg
ggtctggatgatgacagcagtagccaaagtggtgaggcctccaagagtcctcaagagagc
cggcgtctaagcatccagcgttgcatccagtctctggtgcatgcctgccagtgccgcaac
gccaactgctctttgccatcttgccagaagatgaagcgtgtggtgcagcacaccaagggc
tgcaagcgcaagacaaacggtggctgtccggtgtgcaagcagctcattgctctctgctgc
tatcatgccaagcactgccaggagaacaagtgtcctgtgcccttctgcctcaatatcaag
cacaaactgcggcagcagcagctacaacaccggctgcagcaggcgcagatgatgcggaga
cgcatggccactatgcagggtcgagccatgcctcaaagcctaccgtcaccacccgcatcc
acagcccccagcacacccacctcgcatcagcaacccaacacgcctcaaacgccgcaaccg
ctgcccaatcagccgactacgccaaacgctgtcgtaatgtcaccaacctatcccaatacc
ccacgcaatggacaaccccttcctcaagcctcacagggcaaacccggcccacaggcgtcc
ccactacatcagcagcagtctccactcccacagccaccccagcagcagcctccgccgcaa
caacctccgcagcagcagcagcagcctccacctatggcagtcaagatggcacggcacata
gagatggtggcgcaggctcaacagaactatcgcatgaccatgaatggccttcccatgaac
caccagcagccgcgcatgccaggtgcaatgcaaccacccatgcagcttgttgggccacgc
gggcagcaggtcatgcagcccatgccgcaaggacagtggcctggaggcgctcagcctagt
atgccagcagctcagcagcaggtcgctcaacagaccccacagggccctcagtcgaccttg
cctatacagagacccgcaatgccccagcaagttgcccagccacgcatgatggtgcccacg
cagggccctcgaccgcaagcaccccagagagccgcaggcatcgctcctaatgccttacag
gatctgctacgcaccctcaagtcacccagctcaccccaacaacagcagcaagtgttgaac
atcctcaaatcgaacccgcaactcatggcagccttcatcaaacagagaactgcaaagtac
cacgccagccagccccagcagcagcagccacagcagggcatacacgcagcgcagccagcc
atgcagaacatggcagctatgcaggctgtgccacgacctggcatggcccctcagcagcaa
caacagcagcccacaccacaaggcatggcagctcttggtccacagggtcaactcatgaac
cctgcgcccgccaacaaccctcagttacaggaaatgtaccgacggcagcttctgcgacat
cagcagcagcagcagcaacaacagcagcagggagggatgcctcaagctcatggccagttc
ccacaggcacaaggaactgctaccaactacacgcaactccggatgcagcagcagcagttg
gccatgcagggaacaggtggacccatgggccagcttcccccaatggcccagatggctatg
gatggcacacccaaccttttgcaccagcgcaacaatctcctactacagcaacagcagctt
ccgcaacaacaggttgtcctcaagcctcccatgggctcacaggcacaaccgagccccatg
agcccacaaactcaccttctctcgggccagccgcagggcgcacacctacccggccaaccc
atggctaatgcactcagtaatcaggtgtgttcgccaggccccgtacaatcacccagacct
ccgtcacagcagcctcctccacattccagcccttccccacacgttcagcctcagccgtca
ccccaacatgtgccatcccatacggggtcaccacaccctggtctgacaacacccatgcct
ggctccatggatcaaggacatctgggtacgcccgagcagagtgccatgctcccgcagctc
aatacgcccaatcggggagggctgcccagtgacttaaacatggtgggagacacaacagga
gacaccctagagaaatttgtggagggattgtag

DBGET integrated database retrieval system