KEGG   Danio rerio (zebrafish): 566841Help
Entry
566841            CDS       T01004                                 

Gene name
crebbpa, cbp-b, crebbp, si:dkey-206l1.6, si:dkey-44g23.1
Definition
CREB binding protein a
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dre04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dre04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:dre04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:dre04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:dre04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:dre04110]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:dre04916]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 2350 aa AA seqDB search
MAENVLDVGPPNAKRAKLTAPAPDAPELGSLSWDDLENDLPDELIPNGDLGLMSLPSNGG
AAGTGAHGPMVPDAAAKHKQLSELLRPGSSAGMNSVSPQPGGIGPQLGGLGKSPLGQGSP
SHPSQTQKPGGTPGTQGNNAGSAGMGFNQGMLNSGMMGQNAGAQGGQVINGALGTVGRGR
GVQGMYQGAAMQVASSVGAGGGVGAAAPGGAGSVLAETLTQGAQQMGINAQQAKMGMAGG
NSPFGQYQAGGQQLGTNAQNKGALPNSLPPFPTDLKGATVTSVPNMPQQQQVSVGMVAGQ
GVSTGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGDVRACALPHCRTMKNVLNHMTHC
QAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASENANKHNQQPMLSPPNASLQT
PIGSVGTGQQTAPALPSSTPIDPSSMRRAYAALGLPYSNQNPTQTQSPTQTQGPGQTTAQ
TPHQQPMRSINALGGGQLNPIGVPTSEQAKLLPDGTMPSTLNNPVMPDGSTVGNLSNLPT
AAPLSATGVRKAWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGD
MYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIINQTSMTATGQQPSALNQPNVM
GPRPQNGPVPMPNVPNQILNRMQVSQGMNPFSAMSNVPMSQAPMGTRAASPINHQQINMN
QVPTMNMSPTRIAPTQGMLGAHGGNMVTQTPNQTQFMTQPPFPATTNTMNVNMGQPNSQT
PVSQQQPNANLPLNALGPLGPALGCPTPPQAPLRATPPPNATAASTTNLPAALQPSTPTP
APAQATPPHMQTQAELPIPGQQHPGTPTGENRVPTPASAASTELHSQHAVPDVPPNDTKT
EEQDYDMAVKTEPSTETEEDTGSLLVKKEEQEGSEAKQEPMETEDKKTDLKTETKEEDES
KTNGTASSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFD
IVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQ
EIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPRDGTYYSYQNRYHFCEKCFNEIQGD
SVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFI
CDNCLKKSAKSRKENKFTAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDK
TVEVKPGMKAKFVDTGEMMEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTR
RVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTAHIWACPPSEGDDYIFHCH
PADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPN
VLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNAKKKNNKKTNKNKSSLSRANKKK
PGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPIVNSLLPILDSDPLLNCDLMDGRDAF
LTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFD
LCINCYNAKGHEHQMVKWGLGLDDDSSSQSGEASKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQLQHRLQQAQMMRRRMATMQGRAMPQSLPSPPASTAPSTPTSHQQPNTPQTPQP
LPNQPTTPNAVVMSPTYPNTPRNGQPLPQASQGKPGPQASPLHQQQSPLPQPPQQQPPPQ
QPPQQQQQPPPMAVKMARHIEMVAQAQQNYRMTMNGLPMNHQQPRMPGAMQPPMQLVGPR
GQQVMQPMPQGQWPGGAQPSMPAAQQQVAQQTPQGPQSTLPIQRPAMPQQVAQPRMMVPT
QGPRPQAPQRAAGIAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKY
HASQPQQQQPQQGIHAAQPAMQNMAAMQAVPRPGMAPQQQQQQPTPQGMAALGPQGQLMN
PAPANNPQLQEMYRRQLLRHQQQQQQQQQQGGMPQAHGQFPQAQGTATNYTQLRMQQQQL
AMQGTGGPMGQLPPMAQMAMDGTPNLLHQRNNLLLQQQQLPQQQVVLKPPMGSQAQPSPM
SPQTHLLSGQPQGAHLPGQPMANALSNQVCSPGPVQSPRPPSQQPPPHSSPSPHVQPQPS
PQHVPSHTGSPHPGLTTPMPGSMDQGHLGTPEQSAMLPQLNTPNRGGLPSDLNMVGDTTG
DTLEKFVEGL
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatgtgctcgacgtcggccctcccaatgcgaagcgggcgaagctgacagca
cctgctccagacgcaccagagttgggttcactttcatgggatgacctggagaacgatctt
ccagatgagctgattcctaacggagacctggggctgatgtccttgccctcaaacggcggg
gctgcaggtacgggcgctcacggccccatggtccccgacgccgctgccaagcacaagcaa
ctctcggaactcctgcggccgggaagcagcgctggcatgaactctgtcagcccacagcct
ggcggcatcggacctcagcttggtgggctcggaaagagtcccctaggccaaggctcccct
tcccacccttcccaaacacaaaaaccagggggcactcctgggacgcagggcaataacgcc
ggatcagctggcatgggatttaaccagggtatgctgaacagcggcatgatgggacagaat
gctggtgctcaaggaggtcaggtgatcaatggagctcttgggactgtaggccgcggtcga
ggcgtgcagggaatgtaccagggtgctgccatgcaggttgcatcttctgttggagcggga
ggaggagtgggggcggcggcacctggaggagcaggaagtgtcctagcggaaacgctcaca
caaggggcacagcagatgggcatcaacgctcagcaggccaagatgggcatggcaggtggc
aacagtccatttgggcagtaccaggctggaggtcaacaactgggcacgaacgcacagaat
aaaggcgcccttcccaacagcctccccccatttccaactgacctaaagggggcgactgtc
accagcgtgccaaacatgccccagcagcagcaggtgtcggtgggcatggtggcgggtcag
ggcgtatcgacgggtcccacggctgacccggagaagcgtaaactgatccagcagcagctg
gttctgctgcttcatgcccacaagtgccagcggcgcgagcaggccaacggagatgtgcga
gcatgtgctctgccacactgcaggaccatgaagaacgtcctcaaccacatgacgcactgc
caggctggcaagtcctgccaagtggctcactgtgcttcatcgaggcagatcatctcgcac
tggaagaactgcaccagacatgactgtcctgtctgcctgcccctgaagaacgccagcgaa
aacgctaataaacacaaccagcaaccaatgctgagtcccccaaacgctagtctacaaacc
cccattgggtctgtcggcacggggcagcagactgcgcccgctctgcccagctccacaccc
atcgacccaagctccatgcggcgggcgtatgctgccctcggcctcccctacagcaatcag
aaccccacacagacccagtcccccacgcagacacagggccccggacagacaacggcacag
acaccacaccagcagccaatgagatccatcaatgcacttggaggaggtcagttgaaccca
atcggcgtaccgacatccgaacaggctaagctgctcccagatggcaccatgccatcaacc
cttaacaatccggtgatgccagacggctctacagtaggcaatctgagtaacctgcccact
gcggcccctctgtcagccaccggtgtgaggaaagcctggcatgagcacgtcactcaggac
ctccgcaatcaccttgtacacaaactggttcaggccatcttccccacaccagaccctgct
gccctgaaggaccgacgaatggagaacttggtggcgtacgcacgaaaagtggaaggggac
atgtacgagtccgccaacagcagggacgagtactatcactttctggcagagaagatctat
aagatccagaaagagctggaagagaagagaaggtcacggttgcagaagcagatcatcaac
cagacgtctatgactgcaacaggacagcagccatcagccctcaaccagcctaatgtcatg
ggaccgcggccacagaatggacccgtgcctatgcccaatgtgccaaatcagatcctgaat
cgcatgcaggtgtctcaagggatgaatccatttagtgcaatgtccaatgtgccgatgtct
caggctcccatgggaacacgtgccgcctctccgatcaaccatcaacagatcaacatgaac
caagtcccaacaatgaacatgtctccaacacgaattgctccaacgcaagggatgctagga
gctcacggagggaacatggtcacgcaaacgcccaaccagacgcagttcatgactcaacca
ccgtttcctgctaccaccaacaccatgaacgtcaacatgggccagcccaactcgcagaca
ccagtttcgcagcagcagccgaacgctaacctccccctgaatgcacttggccccttgggc
cctgcgctaggctgccccacgccccctcaggctccactgcgcgccacaccgccccccaac
gccaccgccgccagcaccactaacctgccagcagcactgcagccctccacacccaccccc
gcccctgcccaggccaccccgccgcacatgcagacccaggctgagctgcccatccctggc
cagcagcaccctggaacaccgactggtgaaaaccgtgtacccacgccagcgtcagcagcc
agcactgagctgcactcccagcatgctgtgcctgacgtaccacccaatgacactaaaaca
gaagagcaggattacgacatggccgtcaaaacagagcccagcacggagacagaggaagac
acaggctcactgctagtcaaaaaggaggagcaggagggctcggaggccaagcaggagcca
atggagacagaggacaagaagactgacttaaagacggagaccaaagaggaggatgaaagc
aagacaaacggcacagcgtcctcttcaccgtcacagtctcgcaggaaaatctttaagcca
gaagagttgcgacaggctttgatgcccaccttggagtctctgtacaggcaggatccagag
tctctgcctttccggcagcctgtggaccccatacttctaggcatccctgattattttgat
atcgtgaagaaccccatagacctgtccactatcaagcgtaagctggacacgggtcagtac
caggagccctggcagtacgtggatgatgtgtggctgatgttcaacaacgcctggctatac
aacaggaagacgtcacgcgtctacaagtactgctccaaattggcggaggtgtttgaacag
gagattgaccccgtcatgcagggactcgggtactgctgcgggcggaagtacgagttttct
cctcagacgctgtgctgttacggcaagcagctctgcacaataccccgagacggcacttac
tacagttatcagaacagatatcatttctgtgagaaatgcttcaatgagatccagggagac
agcgtgacgctaggagatgatcctgctcagcctcagaccatgatctctaaagaccagttt
gaaagaaagaagaacgacacattagatcctgagccgtttgttgaatgtaaagattgcggg
cggaagatgcatcagatttgtgtcctgcattatgaagtcatttggccttcaggtttcatc
tgcgataactgtttgaaaaagagtgcaaagtcaagaaaggaaaacaagtttacggcaaag
aggttgcagtcaacgaggttaggcacttacatagaggatcgagtgaacaagtacttgaag
aggcagaaccatccggaagctggagaggtgtttgtacgagtagtagccagttcagacaaa
acggtggaggtcaaacctggcatgaaggccaagtttgtggacacaggagagatgatggag
gccttcccctacagaaccaaagcacttttcgcctttgaggaaattgatggagtggatgtg
tgtttttttggcatgcacgtgcaagaatacggctctgattgccctttccctaacaccaga
cgggtatacatatcatacctcgatagtattcacttcttcaaacctcgcatgctgagaaca
gctgtctatcacgaaatcctcattggctatttagaatacgtcaagaagcttggatatgtt
acggcacacatctgggcatgtccgcctagtgagggtgatgactatatcttccattgtcac
cctgccgaccagaaaatcccaaaacctaagcgcctgcaggagtggtaccgcaaaatgttg
gacaaagcctttgctgagcggattctgcatgactacaaggacattttcaaacaagccaca
gaggaccgtttgacgagtgcaaacgagcttccatattttgagggggatttttggcccaat
gtattggaagagagcatcaaggagttagagcaagaggaagaagaaaggaaaaaagaagaa
aacacggcagcttgtgaaactccggagggcacaccaggagacagtaaaaatgcaaagaag
aagaacaacaagaaaacgaataagaataaaagcagcttgagccgagctaataaaaagaaa
cctgggatgccgaatgtagccaatgacctttctcagaagctctacgccaccatggagaaa
cacaaagaggtgttttttgtaattcatctgcattctgggcccatagtcaactccttatta
cccatccttgactctgatcccctgctgaactgtgacttgatggacggaagagacgccttt
ttgacattagcacgggataagcactgggagttcagctctttgcggcgctgcaagtggagc
accatgtgcatgctggtggaattgcacaaccagggccaggaccgctttgtctacacctgc
aacgaatgtaaacaccatgtcgagacacgctggcactgtacggtctgcgaggactttgac
ctgtgtattaattgctacaacgctaagggacatgagcaccagatggttaagtggggtctg
ggtctggatgatgacagcagtagccaaagtggtgaggcctccaagagtcctcaagagagc
cggcgtctaagcatccagcgttgcatccagtctctggtgcatgcctgccagtgccgcaac
gccaactgctctttgccatcttgccagaagatgaagcgtgtggtgcagcacaccaagggc
tgcaagcgcaagacaaacggtggctgtccggtgtgcaagcagctcattgctctctgctgc
tatcatgccaagcactgccaggagaacaagtgtcctgtgcccttctgcctcaatatcaag
cacaaactgcggcagcagcagctacaacaccggctgcagcaggcgcagatgatgcggaga
cgcatggccactatgcagggtcgagccatgcctcaaagcctaccgtcaccacccgcatcc
acagcccccagcacacccacctcgcatcagcaacccaacacgcctcaaacgccgcaaccg
ctgcccaatcagccgactacgccaaacgctgtcgtaatgtcaccaacctatcccaatacc
ccacgcaatggacaaccccttcctcaagcctcacagggcaaacccggcccacaggcgtcc
ccactacatcagcagcagtctccactcccacagccaccccagcagcagcctccgccgcaa
caacctccgcagcagcagcagcagcctccacctatggcagtcaagatggcacggcacata
gagatggtggcgcaggctcaacagaactatcgcatgaccatgaatggccttcccatgaac
caccagcagccgcgcatgccaggtgcaatgcaaccacccatgcagcttgttgggccacgc
gggcagcaggtcatgcagcccatgccgcaaggacagtggcctggaggcgctcagcctagt
atgccagcagctcagcagcaggtcgctcaacagaccccacagggccctcagtcgaccttg
cctatacagagacccgcaatgccccagcaagttgcccagccacgcatgatggtgcccacg
cagggccctcgaccgcaagcaccccagagagccgcaggcatcgctcctaatgccttacag
gatctgctacgcaccctcaagtcacccagctcaccccaacaacagcagcaagtgttgaac
atcctcaaatcgaacccgcaactcatggcagccttcatcaaacagagaactgcaaagtac
cacgccagccagccccagcagcagcagccacagcagggcatacacgcagcgcagccagcc
atgcagaacatggcagctatgcaggctgtgccacgacctggcatggcccctcagcagcaa
caacagcagcccacaccacaaggcatggcagctcttggtccacagggtcaactcatgaac
cctgcgcccgccaacaaccctcagttacaggaaatgtaccgacggcagcttctgcgacat
cagcagcagcagcagcaacaacagcagcagggagggatgcctcaagctcatggccagttc
ccacaggcacaaggaactgctaccaactacacgcaactccggatgcagcagcagcagttg
gccatgcagggaacaggtggacccatgggccagcttcccccaatggcccagatggctatg
gatggcacacccaaccttttgcaccagcgcaacaatctcctactacagcaacagcagctt
ccgcaacaacaggttgtcctcaagcctcccatgggctcacaggcacaaccgagccccatg
agcccacaaactcaccttctctcgggccagccgcagggcgcacacctacccggccaaccc
atggctaatgcactcagtaatcaggtgtgttcgccaggccccgtacaatcacccagacct
ccgtcacagcagcctcctccacattccagcccttccccacacgttcagcctcagccgtca
ccccaacatgtgccatcccatacggggtcaccacaccctggtctgacaacacccatgcct
ggctccatggatcaaggacatctgggtacgcccgagcagagtgccatgctcccgcagctc
aatacgcccaatcggggagggctgcccagtgacttaaacatggtgggagacacaacagga
gacaccctagagaaatttgtggagggattgtag

DBGET integrated database retrieval system