KEGG   Danio rerio (zebrafish): 567050Help
Entry
567050            CDS       T01004                                 

Gene name
usp28, im:7138195
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 1163 aa AA seqDB search
MRVEQEFEHGETSENSSQMLLNQLREITGIQDPQVLQSALNAGQGDISHAIGLLTTQPPE
EEHMPEQTTTANNEKNTSSAQNGPAKDDLQTAIELSLQESQQAEAERRELHRALEVSAEE
NAARIKRKRCEGSGESCSPAEWIRQEDCPVGIRNVGNTCWFSAVIQSLFHLPVFRRLVLN
YCLSERVLEKCKSHSEKRNIAFMQELRCLFALMVGSNRRFVDPSAAVELLRDAFRTSEAQ
QDVSEFTHKLLDWLEDAFQLAANGTNPEDKQNNPMVQLFYGTFVAERLHEGEIVSNIEQF
GQYPLQVNGFNNLDECLEGAMVEGEIESLHSDQTLSSGQERWFSKLPPVLTFELSRFEFN
QSLGRPEKIHKKLEFPQVIYMDRYLHKNVNQTHGRRGEVKRLKDQLTLLQQKLEGYKNYG
SGPAKYPLADMLQYVLEFATTKPTNPGSPVPTNPPISTDPSSGDSSQTEADDAGSSDGSG
CPPTATQRTPIHKPFTQCRPPMEVPVQPAPHSVSEEELHFIRSCLQRWRAEVENTISELK
ASIDKVSQALEGMYSDNSLCQVPYRLHAVLVHEGQASAGHYWAYIYDHAQRRWLKYNDVL
VAESTWEELVRDSYGGMTNASAYCLMYINDNLPYLIAEDTDVETGQVLKGMDSLPSVLRR
YVREDNRWFQQELREWEEQFCQAQRDETPVQTNTSTSTEQPVPEEPQNPEPEPTQEQTNE
DTEEPPSDSTPAPVQESEEPTVSPLNPISPEASENEEQINGSQTQDQPEEEKPDQSQSVS
AGELETETEVEEQVTNPEGGAEAEVDAQTDPEASSTEESTAEDTNTQPENEVSEVEIPNV
GKILVRSDVDGYNEEMMLTPAMQGVIFAIAKAREAFDKDGPEAGLIKAFHEEYLRLYELS
QEETTPQQDPRLQHVLVYLFQNKAPERVIERTLLEQFGDRNLSFDDRAVSIMREARSKLR
LIRPEDMDMDEYLQWHDDYSMFKTVFAYLLTGLEQYQNGKIREALIYLAHAHQDNSALLT
KGERKGVDQSLIALYRRKCLKELNEKAATLFKSQDESDVTEGESLMNECVIPCMHLMVRD
SVSQEDLDVIELIRNCWCSYLGQDMDDSLQEKLSEFLPRVLDCSAERVVLKEPPKVRKSP
HDLCSRLAAVMESIHSASVVIVK
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgagagttgaacaagaatttgaacatggggaaacgtctgaaaactcgagccaaatgcta
cttaaccagctcagagagattactggcattcaggatccgcaggttctccaaagcgccctg
aacgccggtcagggtgacatcagccatgccattgggctcctgaccactcagcccccagaa
gaggagcacatgccagagcaaaccaccacagccaataatgagaagaacacctccagtgca
cagaacggacctgctaaagatgatctgcagactgccattgagctgagtctacaggagtca
cagcaggccgaagcagagcggagagagctgcacagggctctggaggtcagcgcagaggag
aatgcggcccgtattaagaggaaaaggtgtgaggggtctggagaaagctgcagtcccgct
gaatggatccggcaggaagactgtcccgtgggtatccgaaatgtaggaaacacctgctgg
ttcagtgctgtcatacagtctctgttccacctgccagtctttcgtaggctggtcctcaac
tactgtctgtctgagcgtgtgctggagaaatgcaagagtcattcagagaaaagaaacatt
gcctttatgcaagagttgcgatgtttgtttgctctgatggtcggctcgaaccgcaggttt
gtcgacccgtctgcagcagtggagcttctcagggacgcgttcagaaccagcgaagcacaa
caggatgtcagtgaattcacacacaagttgcttgactggctggaggacgccttccagctg
gctgctaatggaactaacccagaggataaacaaaacaaccccatggtccagctgttttat
ggcacatttgtggctgagaggcttcatgaaggagagattgtgtccaacatcgagcaattc
ggacaataccctctccaagtgaacggcttcaataatttagatgaatgtttggagggggca
atggttgagggagagattgagtctcttcattcagatcagacactctcctccggccaagag
aggtggttctccaagctgccgccagtgttgacctttgaactgtccagatttgagttcaat
cagtctttggggcgacccgaaaaaatacacaaaaaactggagtttccccaagtgatctac
atggacagataccttcacaaaaatgtcaatcagactcacggcaggagaggagaggtcaag
agactcaaggaccagttaacacttctacagcagaagcttgagggatataaaaactacggc
tcagggccagccaaataccctctggcagacatgttgcagtatgtcctagagtttgccacc
acaaaacccacaaatccaggttcaccagtacctacaaaccctcccataagcacagatccc
agctcaggtgacagcagtcaaacagaagcagatgatgccggctcgtcagatggttcgggc
tgcccgccgacagcgacgcagagaacgcccatccacaagccttttactcagtgcagaccc
cctatggaggtgccagtgcagccggcgccacacagcgtgagcgaggaggagctgcacttc
atcaggagctgcttacagcgctggagagctgaagtggagaacactataagtgagctgaaa
gccagcattgacaaggtcagccaggccctggagggcatgtactcagataacagtctgtgt
caggtgccctatagactacacgctgtgctcgttcacgaaggacaggcctccgctggacat
tactgggcctatatttatgatcacgctcaaagacgctggctgaagtataatgatgtattg
gtggcggagtcgacctgggaagagctggttcgagactcgtacggtggcatgaccaacgct
agcgcctactgcctcatgtacatcaatgacaatctgccgtacctcatagcagaggacaca
gacgttgaaactgggcaggttctgaaaggaatggattctcttccatcagtcctgaggcgt
tacgttcgggaggacaaccgctggttccagcaggagctgagggaatgggaggagcagttt
tgtcaggcccaacgggacgaaacaccagtgcaaacaaacacatccaccagcacagagcaa
cccgtcccggaagagccacaaaacccagagccagaaccaactcaagaacaaaccaatgaa
gacactgaagaaccaccatcagattcgacaccagcacctgtccaagaatcggaagagccc
acagtcagtcctctcaacccgatatcaccagaggccagtgagaatgaggagcagatcaac
gggagccaaactcaggatcagccagaagaagagaagccagatcagagtcagtcggtctct
gcaggtgaacttgagacagaaactgaggtggaggagcaggtcaccaatcctgaaggagga
gcagaggcagaagtagatgcacagactgatccggaagcctcatccactgaagaaagcaca
gctgaagacacaaacacccagcctgagaatgaggtttctgaagtcgagattcccaatgta
ggcaagattctggtgcgctctgatgttgacggctacaatgaggagatgatgttaacacca
gccatgcagggggtgatttttgccattgccaaggcaagagaagcctttgataaagacgga
cctgaagcaggactcatcaaggcgtttcatgaggagtatttgagactgtatgaactgtcc
caggaagagaccacaccgcagcaggacccccggctccagcatgtgctggtctaccttttt
caaaacaaggcccctgagcgagtcattgaaaggacgttgctggagcagtttggtgatcgt
aacctgagcttcgatgatcgggccgtcagcatcatgagagaggccagatcgaaacttcga
ctaattagaccagaagatatggacatggatgagtatttgcaatggcatgatgactacagc
atgttcaagacagtgttcgcctacctgttgacaggtctcgagcaatatcagaatggaaag
ataagagaagctcttatttatctggcacacgcacaccaggacaactcagccctgctcaca
aaaggagagaggaaaggagtggaccagtcacttattgcactttacaggagaaagtgtctg
aaagagctgaatgagaaggcagccacgctgtttaaaagtcaggatgagagtgacgtgacg
gagggagagagcctcatgaatgagtgtgtgatcccttgcatgcacctcatggttcgagac
agtgtcagccaagaggacctggatgtcatcgagctgatcaggaattgctggtgctcctac
ctggggcaggacatggatgattctcttcaagaaaagctcagtgagttcctgcccagagtt
ctagactgctctgcagaacgagtggtgctgaaggaaccccctaaagtgaggaagtcccct
cacgatctgtgcagtcgcctggcagccgtcatggagtccattcacagcgcctctgtcgtc
atcgtaaagtga

DBGET integrated database retrieval system