KEGG   Danio rerio (zebrafish): 567111Help
Entry
567111            CDS       T01004                                 

Gene name
crebbpb, CBP-A, gb:dq017638, wu:fp53a03
Definition
CREB binding protein b
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    567111 (crebbpb)
   04330 Notch signaling pathway
    567111 (crebbpb)
   04350 TGF-beta signaling pathway
    567111 (crebbpb)
   04630 Jak-STAT signaling pathway
    567111 (crebbpb)
   04068 FoxO signaling pathway
    567111 (crebbpb)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    567111 (crebbpb)
  Cellular commiunity
   04520 Adherens junction
    567111 (crebbpb)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    567111 (crebbpb)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    567111 (crebbpb)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     567111 (crebbpb)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    567111 (crebbpb)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    567111 (crebbpb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 2435 aa AA seqDB search
MADNLLDMGPSAAKRPKLNSPALSSSDTPDFVSLFDLENDLPDELIPNGDLGLMSMPSNG
DGGVGSRMGGNVPDAAAKHKQLSQLLQAGSGSGLGGNLSPQSGMGGQLGALGKSPMGQGS
PGHQTQAPKPVGTPTGQGNNSPGMGMNTGFNPAMLNNNNQAHGLMGQNMTPQGQMMNGVM
GPAGRGRTAPGMQYQGQGMQGAPVGAGGGQGVGVSGSVLAETLTQGAPQMGAHNAINQQA
GNMNKMGLATANGPFGQQYVQGSVQQMSNAGLNAQMQNKAALPNSLQPTLKGASSVPNLL
QQQVPSVGMVPGQGVSAGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHC
RTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPM
LSSPNPGMQSPLGQVGTSQPAAPAISSGTHIDPSSMQRAYAALGLPYGNQPAAQTQVAGQ
QPTQTQQMRSMAALGSNQMNIGGNGMADQTNLHTDSSLPSSLSSNQMMPDGSNMGGAGNL
PTAAPLSMPGMKKPWHEHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVE
GDMYESANSRDEYYHFLAEKIYKIQKELEEKRKSRLSKPQMGAQGPQQPGLPQPNPMGPA
QAIRPPNGPVSMSNVPNQLMARMQVPQGMGQFNPVTMQNVQMSQSQVGAPRAASPMTHNP
QMGMGNVPPMVMSPSRMPQAQAMMGGHANNMVGQTPNQNQFMNQTPFPASAGGMNVNVNL
AQQSGQTVQQQQQQNANLTLNAVGSLGPPSALCSTPPPPSASTPSAAASLQSLQTQPSTP
ASVGGHVTPTHIPSGLPRPPSVLGSSPAPSQPHTPLQSQPEPPMQMQQPTSVQAQQPSTP
LSQMAPSVDNRVPTPASVAETHSQQALPDYPAAEPKIEHQEDEQEVESGKKRPDIKMEDE
DVKPPQVKEQPETVEPKQEPMETEDKKPETKTEPKEEEVSSTNSSTPANQSAQSRKKIFK
PEELRQALMPTLEALYRQDPESLPFRQPVDPNLLGIPDYFDIVKNPIDLSTIKRKLDTGQ
YQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEF
SPQTLCCYGKQLCTISRDGTYYSYQNRYHFCEKCFNEIQGDSVTLGDDPTQSQTYVSSAA
QKSLSMISKEQFEKKKNDTLDSEPFVECKDCGRKMHQICVLHYDVIWPSGFICDNCLKKS
GKSRKENKFSAKKLQCTRLGSYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGM
KSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLD
SIHFFKPRLLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPK
PKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRLTSAYELPYFEGDFWPNVLEESIKE
LEQEEEERKKEENTASSETTEGAQADSKNAKKKNNKKTNKNKSSVSRANKKKPGMPNVAN
DLSQKLYATMEKHKEVFFVIHLHAGPVVNTLPPIMDPDPLLTCDLMDGRDAFLTLARDKH
WEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNS
KGHEHQMVKWGLGLDDDSNNQGGEANKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSC
QKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQI
QQRLQQAQMMRRRMALMQGRGMPPSLPSPTTSGGPGTPNSQQLQQPNTPQTSQALANQPQ
QTHPNVAAMVQAFPNQPPTPGSQGKPGPQSSPLPQQQSPLPIPPQQQPQPSPQQQALKVA
KQIEMMTKVKQQQQQQQQQQQQQQQQQQQQQQQQQQQDYRMSMNGMPMNQPRMMTSMQMM
GPRGPQMVQNMQQGQWAPGMAMQNPQGPPPQQVPQQQMAMAQQQSQVAQTPQQAQMIQRA
LMQQQQQQQQQPRQIQAVMPPQQVQPQAPQQQGMQQRGVTSNITPGALQDLLRTLKSPSS
PQQQQQVLNILKSNPHLMAAFIKQRTAKYQANQPQQQQNPQAMLASQQGMQNMAAMQPGS
VQRPVMPPQQQPQPQPAATQAMAALGSQGQMMNAAHNGNQQLFRRQLLRQMQQQQQHQQQ
QGAMPPGQGRFPQPQGAASYSQIRVQQQMAMQGGAGPMGQMPPMAQMGQPGMGLDAQQQQ
NLMQQRMLQQQQQQQQQMMKQQMGSPAQAASMSPQPHMLGGQPQGAHMPGQAMANALGNQ
VRSPAPVQSPRPPSQQPPHSSPSPRMQPQPSPLHPGSSHPSLAGPMPGPMDQAHMCTAEQ
SAMLPQLNTPNRGGLTNDLNMDTTGDTLEKFVEGL
NT seq 7308 nt NT seq  +upstreamnt  +downstreamnt
atggctgataatctactggatatgggtccctccgccgcaaagcggcccaaactgaactca
cctgccctatcctcctccgacactccagacttcgtgtccttgttcgacttggaaaatgat
cttccagatgagctgatacccaacggagacctgggcctgatgtccatgccctctaatgga
gatggaggggttggaagcaggatggggggcaatgtcccggatgctgctgccaagcacaag
cagctatcccagctcttgcaggcagggagcggctctggtctgggtggaaacctcagccct
cagtctggtatgggtggacaactgggtgccttgggcaagagtcccatgggccagggctca
cctggacaccagacccaagctcccaagcctgtcgggacccctaccggtcagggcaacaac
agccctggaatgggcatgaatacaggtttcaacccggccatgctgaacaataacaaccag
gctcatggacttatggggcagaacatgactccgcaggggcagatgatgaatggtgtgatg
ggaccggccggaagaggcaggacagctccagggatgcagtaccagggacagggcatgcag
ggggcacctgtcggagcaggcggtgggcagggagtcggtgtttctggcagcgtattggcg
gagacgcttacccagggtgcaccacagatgggggcacacaatgccatcaatcagcaagcg
gggaatatgaacaagatggggcttgcaacagctaatggtcctttcgggcagcagtacgta
cagggttcggttcagcagatgtccaacgctggattaaacgctcagatgcagaacaaggca
gctcttcctaacagcctccagcccaccctgaagggtgcttccagcgtgccaaatctgctg
cagcagcaggtgccctctgtgggcatggtcccgggacagggagtttcggcaggccccacg
gccgacccagagaagcgcaaactgatccagcagcagctggtcctgctgcttcacgcccac
aagtgccagcggcgagagcaggccaacggagaggtgcgcgcctgcgccctgccccactgc
cgcaccatgaagaacgtcctcaaccacatgacccactgccaggcgggaaaatcctgccaa
gtggctcactgcgcctcatcaagacagatcatctcacactggaagaactgcacccggcac
gactgccctgtctgtctgcccctgaaaaatgccagtgacaagagaaaccagcagccgatg
ctgagctccccgaatcctggcatgcagtctccgctggggcaggtgggcacgagtcagcct
gcggcgcccgccatcagcagcggcacacacatcgaccccagctccatgcagagggcgtac
gcagcgctgggcctcccgtacgggaatcagcccgccgcacagacacaggtcgcaggacag
cagcccacgcagacgcagcagatgcgctccatggccgcattaggctctaaccagatgaac
atcggtggtaatggtatggccgatcagacgaaccttcacactgattcctctctcccctca
tcactcagcagcaaccagatgatgcccgacgggtcgaatatgggtggcgcagggaacctg
cccactgctgcgccgctgtcgatgcccggcatgaagaaaccctggcacgagcacgtcact
caggacctgaggaatcacctagtgcacaagctagttcaagccatattcccgactcctgac
cctgcagcactgaaagacagacgcatggagaatttggttgcttatgcacggaaagtggag
ggagacatgtatgagtctgccaacagcagggatgagtattatcactttctggctgagaag
atctataagatccagaaggagctggaggagaagagaaagtccaggctgtcgaagccgcag
atgggcgctcagggtcctcagcagcctggccttcctcagcctaaccctatggggcctgca
caagccatccggccaccaaatggacctgtctccatgtccaatgtgccaaatcagttgatg
gcccggatgcaggttcctcaagggatgggccagttcaaccccgtgaccatgcagaatgtg
cagatgtcccagtcgcaggtgggagctcctcgggctgcatcacctatgacccacaaccct
cagatgggcatggggaacgttccaccgatggttatgtctccttccagaatgccgcaagct
caagccatgatgggaggacatgctaataacatggtgggccagacacccaaccagaaccag
ttcatgaaccagacaccgttcccagcctcggccgggggcatgaatgtgaatgtaaacctg
gcccagcagtcaggacagactgtccaacagcagcagcagcagaacgctaacctgaccctg
aacgctgtgggctctctgggcccgccgtccgccctgtgctccacccctcctccgccctcc
gcctccaccccgtcagccgctgccagcctgcagtcactccagacccagccctccacgcca
gcctccgtcgggggccacgtcacgcccacccacatccccagcggcctgccccgtcctccc
tctgtcctgggctcctcccctgccccgtcccagccgcacacacccttgcagtcccagcct
gagccccccatgcagatgcagcagcccacctctgtgcaagcgcagcagccaagcactccg
ctctctcagatggctcccagtgttgataatagagtccccacgcctgcttctgtggctgag
acacactcccagcaggccttgcctgactatcctgctgccgagcccaaaatcgagcatcaa
gaagacgagcaggaagtggagtctgggaaaaaacggcccgatattaagatggaggatgaa
gatgtcaagcctccacaggtgaaggagcagccggagactgtagagcccaaacaggaaccg
atggagactgaggacaagaaaccggagacaaagactgagccgaaagaagaagaagtgtcc
agtactaacagctccactccagccaaccagtctgctcagtcacgaaagaaaattttcaaa
ccggaggagctcagacaagcgctaatgcctaccttggaagctctgtatcgccaggaccca
gaatccttgccatttcgccagccagtcgacccaaatttactgggcatcccggactatttt
gacattgtgaagaacccgattgacctttccaccattaagaggaagttggacaccgggcag
taccaggagccctggcagtacgtggacgacatctggctgatgttcaacaacgcctggcta
tacaaccgcaaaacatcgcgagtatacaagtactgctctaagctggctgaggtgtttgag
caggagatcgacccggtcatgcagggtctgggatactgctgtggacgcaagtatgagttt
tcacctcagacgctttgctgctatggcaaacagctctgtacaatctcccgggacggcaca
tattacagctaccaaaacaggtatcacttctgcgagaagtgcttcaatgagattcagggc
gacagtgtcactctgggggacgacccgacccagtcgcagacgtatgtatcatctgctgcc
cagaagtctttgagtatgatatcaaaggagcagtttgagaagaagaaaaacgacacgttg
gactctgaaccctttgttgaatgtaaagactgtggccggaagatgcatcaaatctgcgta
ctacattatgacgtcatctggccatcaggtttcatctgtgacaactgcctgaagaagtca
ggaaaatcaagaaaggagaacaagttttctgctaaaaaattacagtgcacgaggctgggc
tcatacattgaggaccgagtgaataagtacttgaagaggcagaatcacccagaggccgga
gaggtgttcgtacgggtggtcgccagctctgataagaccgttgaggtcaaacctggcatg
aaatcgaggtttgttgactcaggagagatgtcggaaagctttccctacagaaccaaagca
ctttttgcatttgaggagattgatggagtggatgtgtgtttcttcggcatgcacgtccag
gaatatggatctgattgtccctttcctaacaccaggcgggtatacatatcatatcttgac
agtattcacttctttaaacctcgattgctaagaactgcggtttaccatgaaatcctcatc
ggctatttggagtatgttaagaaacttggatatgtgactggtcatatctgggcctgtcca
cctagtgaaggtgatgactacattttccactgtcaccctcctgatcagaagattcccaag
cctaaaagactccaagagtggtaccgcaaaatgctcgacaaagcctttgcagaaagaatc
attcacgactacaaggacatatttaagcaggccacggaggaccgacttacaagtgcctac
gagctgccctatttcgagggtgatttttggcccaatgttctggaggaaagcatcaaagag
ctggagcaggaggaggaggagaggaagaaggaggagaatacagcctcctctgagacaaca
gagggagcccaagctgacagcaagaacgccaaaaagaagaacaataaaaagaccaacaaa
aataaaagcagtgtgagccgcgccaacaaaaagaaacctgggatgccgaatgtagctaat
gatctgtcccagaagctatatgcaacgatggagaagcacaaagaggtcttcttcgtgatc
cacctgcatgctggtccagtggtcaataccctgcctccgatcatggaccctgaccctctg
ttgacctgcgatctgatggacggccgcgatgccttcctgaccctggccagggacaagcac
tgggaattcagctctcttcgccgctgcaaatggagcactatgtgtatgctagtggagctg
cacaatcagggccaagaccgatttgtgtacacttgcaacgaatgcaagcaccatgtagag
acacgctggcattgcaccgtttgcgaggactttgatctatgcattaactgctacaactcc
aagggtcatgagcaccaaatggttaagtggggtttgggtctggacgacgacagcaacaac
cagggcggcgaggccaacaagagcccacaggagagtcgacgcctcagcatccagcgctgc
atccagtccttggtgcatgcctgtcagtgccgcaatgccaactgctctctaccatcttgt
cagaagatgaagagagtggttcagcacaccaagggctgcaagcgcaagacaaacggaggc
tgccctgtttgcaagcaactcattgcgttgtgctgctaccatgccaagcactgccaggag
aacaagtgtcctgtacccttctgtctcaatatcaagcacaagctgcggcagcagcagatt
cagcagcgactgcagcaggcgcaaatgatgcggcggcgtatggcactcatgcagggcaga
ggaatgcctccgagcttgccctccccaactacctcaggaggtcccgggacgcccaactct
cagcagttgcagcagcctaatactcctcagacctcgcaggcattagccaaccagccccag
cagacgcatccgaatgtggctgcaatggtgcaagccttccctaaccaaccccctacacca
gggtcgcaaggtaaaccagggccgcagtcctctcctttgccccaacagcagtctccacta
cccataccgccccaacaacagccgcagccctctccgcaacagcaggctttaaaggttgca
aaacaaatagagatgatgaccaaagttaagcagcagcagcagcagcagcagcaacaacaa
caacaacaacaacagcagcagcagcagcagcaacaacagcagcagcagcaagactacaga
atgagcatgaatggcatgccaatgaaccagcctcgcatgatgacttccatgcagatgatg
ggccctcgtggtccgcagatggttcagaacatgcagcagggtcagtgggcacctgggatg
gcaatgcaaaacccacaggggcctcctccacagcaggtgccccagcagcagatggccatg
gcgcaacagcagtctcaggtagcgcagacgccccaacaggcgcaaatgattcagcgcgcc
ctgatgcagcagcagcagcaacagcagcagcaaccgcgtcaaattcaggccgtcatgcct
ccccagcaggtgcaaccccaggccccgcagcaacaaggcatgcagcaaagaggtgtaacc
agcaacattactcccggagcgctgcaggacctgctgcgaacattaaaatcaccaagttcc
cctcagcagcaacagcaggttcttaacatcctcaagtcaaacccacatctcatggctgcg
ttcatcaaacagcggacggcaaaataccaggccaatcaaccacagcagcagcagaacccg
caggccatgctcgctagtcagcagggaatgcagaacatggctgcaatgcaacccggttcc
gtccagagacctgttatgccccctcagcagcagccgcagcctcagcctgctgcaacccaa
gctatggctgccctcggatcccagggacaaatgatgaacgctgcacataatggaaatcag
cagctgttccgccggcagttattgcgtcagatgcagcagcagcagcagcatcaacaacaa
cagggagccatgcctcctggtcaggggagattcccgcaaccccaaggagcagcaagttat
tcgcaaatccgcgtgcagcagcagatggccatgcagggtggcgcaggaccgatgggccag
atgccgcctatggctcagatgggccagcctggcatgggcttggatgcccagcagcagcag
aatttgatgcagcagcgcatgctgcagcagcagcaacaacagcagcagcagatgatgaag
cagcaaatgggctcgccggcacaagccgcttccatgagtccccaaccccacatgcttggg
ggacagccgcagggagctcacatgcccggacaggccatggccaatgcgctgggtaaccaa
gtgaggtcgcctgcgcctgtgcaatcaccccgtcccccgtcccaacaaccgccacattcc
agcccgtctccacgcatgcagccccagccttcgcccctacaccccggatcctcccatccc
agcctggcaggacccatgccgggcccaatggaccaggcgcacatgtgcacggctgaacag
agtgcaatgcttccgcagctgaacacaccaaaccgtggagggctcaccaacgacttgaat
atggacaccacgggagacacgttagagaagtttgtggagggattgtag

DBGET integrated database retrieval system