KEGG   Danio rerio (zebrafish): 568202Help
Entry
568202            CDS       T01004                                 

Gene name
por, zgc:110032
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 674 aa AA seqDB search
MEDTEPQPVSDQDQTPDPLLSSLDIFLFSLIAGLLIYWFFFRKKVEPIPEMKPFTLVTAP
IRETSFIEKMKKTNRSVVVFYGSQTGTGEEFANRLSKDAHRYGMKGMAADPEEYDMSELS
RLKEIPKSMAVFCMATYGEGDPTDNAQEFYDWLQGTDDDLEGVNFAVFGLGNKTYEHYNA
MGKYTDKRLAELGGKRVFDLGLGDDDSNLEEDFISWKEQFWPAVCEYFGVEATGEDSSIR
QFELVVHNDINMNQVYTGEMGRLKSFQTQKPPFDAKNPFLASVAVNRKLNKGGNRHLMHI
ELDITESKIRYDSGDHVAVYPTNDSAMVNRIGERLGVDLDAVISLKNLDEESNKKHPFPC
PTTYRTALTHYLDINNMPRTNVLYELAQYASDPQEQENMRKMASASPEGKALYQSWVLDS
ERNILAILEDLPSLNPPIDHLCELLPRLQARYYSIASSSKVHPHCIHICAVVIEYNTKTG
RVFKGVATNWLKGKHVTDNGHKPTVPMYVRRSQFRLPFKPSNPVIMIGPGTGIAPFMGFI
QERAWRKEQGKDVGETILYFGCRHSNEDFLYQQELEEFERAGVLTQLNVAFSRDQEQKVY
VQHLLKKNKQQLWKLIHTDNAHIYVCGDARNMARDVHAAFSEIAEQEGRLTHTQALDYFK
KLMTKGRYSQDVWS
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggaggacactgagccacagccggtctccgatcaggatcagactccggatcctctcctc
agctctctggacatctttctcttctccctaattgcaggattgcttatctactggttcttc
ttccgaaaaaaagtagagcctattccggagatgaagcctttcactttagtaacagcacca
atacgtgagaccagctttattgagaaaatgaagaaaacgaatcgaagcgttgtggtgttt
tacggatcccaaacagggactggtgaagaatttgctaaccgactttcaaaagatgcccat
cgctatggcatgaaagggatggcagctgacccagaggagtatgacatgtctgagttgtcc
cgactgaaagagattcctaaatcgatggctgtgttctgcatggcaacctatggagaggga
gaccctacagacaacgctcaggagttctatgattggttgcaagggacagatgacgatctg
gagggggttaattttgctgtgtttggtttaggaaataaaacatatgagcactacaatgcc
atgggcaagtacacagacaagagacttgctgaacttggtgggaaaagagtctttgacttg
ggcctcggcgatgacgacagcaacttggaggaggactttatatcttggaaggagcagttt
tggcctgcggtgtgtgagtattttggcgtggaggccactggagaggacagcagcattcgg
cagtttgaactggtggttcataatgacatcaatatgaatcaagtgtacaccggagagatg
ggccgcctcaaaagctttcagacgcagaaaccaccgtttgatgccaagaaccctttcctt
gcatccgtggctgttaatcgtaagctgaacaaaggaggaaaccgccatctgatgcatatc
gagttagacatcactgagtccaagatcagatatgattctggagatcatgttgctgtttac
cccaccaatgattctgctatggtcaacagaataggagagagacttggagtagatctcgat
gctgtaatctctctcaaaaatctggacgaggagtccaataaaaagcaccctttcccctgt
cccaccacatatcgcactgcactgacccactacctcgacatcaacaacatgccccgtacg
aatgtgctgtatgagctggcgcagtatgcctcggatccgcaggaacaggagaacatgcgc
aagatggcatctgcgtcgcctgaaggaaaggctctctaccaaagttgggttctggattcg
gagaggaacatattggctattctagaggatctgccttcgctgaatcctcctatagatcac
ctgtgtgagttgctgcctcggcttcaggctcggtactactccatcgcctcctccagcaag
gttcatccacactgcatccacatctgtgcagtggtgatcgagtacaacaccaaaactgga
cgagtcttcaaaggtgtcgccaccaactggctgaagggcaaacatgtgactgataacggc
cacaagcccaccgttccaatgtacgtcaggagatcccagttccggctgccgttcaaaccc
agtaaccctgtgatcatgattggtcccgggactggtatcgcccccttcatgggcttcatt
caggagagagcctggcggaaagagcaaggaaaggatgttggtgagacgatactttacttt
ggctgtcgccatagcaacgaagacttcctgtaccagcaggaactggaggaatttgagagg
gcaggcgtgctgacgcagcttaacgtggccttttccagagaccaggagcaaaaggtctat
gtgcagcatcttctgaagaaaaacaagcagcagttgtggaagctcatccatacagataat
gctcatatctacgtttgtggagatgctcgtaacatggctagagatgttcacgcagccttc
tcggagatcgcggagcaggaaggacgcctgacacacactcaagctctggactatttcaag
aagctcatgaccaagggccgctactcgcaggacgtctggagctaa

DBGET integrated database retrieval system