KEGG   Danio rerio (zebrafish): 568213Help
Entry
568213            CDS       T01004                                 

Gene name
tesk2, zgc:158349
Definition
testis-specific kinase 2 (EC:2.7.12.1)
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 634 aa AA seqDB search
MERSKRNSIAGFPTRPDRLDDLDSGGGAETSSLPLDRVCPSSYRALISAFSCLTRLDDFI
CEWIGSGFFSEVYKVRHRASDQVMALKMNKLSSNRANMLREVQLMNRLSHPNILRFMGVC
VQEGQLHALTEYINGGNLEQLLDSNKFLSWATRVKLALEIAMGLSYLHSKGIFHRDLTSK
NCLIKSDENGYTAIVGDFGLAEKIPSHDYEGEKLSVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYHAFQHMVGDCPADFLQLAFNCCNMDPKLRP
SFPDIVKRLEEIQKKLKAEESERERMLLTAGEVEKKPIPKGPGEKGIKRLNPLGFQDDKI
PPKSPRPRRNIWLSRSQSDIFARKPARKVNVQDPYYNPEPRGFIHGLPKVNPFSAREDLK
GGKIKFYDMPSKSVFSLMFDLHSPHGSQSSQQPQPNISGANNWPEPWQLPGRQCRSLPVS
PQLPHSEVLFSSHPASRSEAAQPNGESRQRTLNSWAKKFTVTEIPPYKPRADREEEVEAT
EDWSSLIPSDGGETEAMDCSSSRGSPADDKDTTLNQMHNGFCEDMEAEDQDGVLVTNKNS
LTLSMSVEPQELCPIVLTACKASSSGERISRCDI
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggagcggagcaagcgcaactccattgctgggttcccaactcggcctgatcgcctggat
gacctggattctggaggaggagcagaaaccagttcattaccactggatagagtgtgtccc
tcttcttaccgggccctcatcagtgccttttcttgcctgacccgacttgatgacttcatc
tgcgagtggattggctctgggtttttttcagaggtttacaaggtgcgccacagagcttcg
gaccaggtgatggcactaaagatgaacaagctgagcagtaatcgtgccaacatgctgcga
gaagtacaactcatgaacagactgtctcacccaaacattctcagattcatgggggtgtgt
gtacaggaaggtcagctccatgcgctcacagagtatattaatggtggaaacttggagcag
ctgctggacagcaataagttcctgagctgggccacaagagtcaagctggccttagagatt
gcaatgggcctcagttacctacactccaagggcatatttcaccgagatctcacctccaag
aactgcctgatcaagtctgatgagaacggctacactgcgatcgtcggagacttcggcctt
gctgagaaaatccccagtcacgattatgagggggagaagctatctgtggtgggatccccg
ttctggatggctccagaagtgttgagagacgaaccgtacaacgaaaaggctgatgtcttt
tcgtatggcattattctgtgcgaaatcattgcaaggatacaggctgacccagactacctg
ccacgcactgaaaactttggtctggattatcacgcctttcagcacatggttggagattgt
cctgctgacttccttcagctcgccttcaactgctgcaatatggatccaaagctcaggccc
tccttcccagatatagtaaagaggctggaagagatccagaaaaagctgaaagcggaagaa
tctgagagggagaggatgctactaaccgccggagaggtggagaaaaaacccatccctaaa
ggtcctggagagaagggcataaagaggttaaatccgcttggttttcaggatgacaagatt
ccccccaaatccccccgtccacgtcgcaacatctggctttcccgcagccagtctgacatt
ttcgctcgcaaaccagcgcgcaaagtgaacgtccaggacccttactacaaccccgaacct
agaggctttattcacggcctaccgaaagtcaaccctttcagcgccagagaggacttaaaa
ggtggcaagatcaagttttacgacatgcccagcaaatccgttttctcgctcatgtttgat
ttgcactcaccacacggcagtcaaagctcacaacagccgcaacccaatatcagcggagcc
aacaactggccagagccctggcagctgcccggccgacagtgccgctcgctccccgtctct
cctcaactgccccattcagaagtcttattctcatctcatcccgcatccagaagcgaagca
gcacaacccaacggtgaaagcagacaaagaactctaaacagctgggctaagaagttcacc
gtaaccgaaatccctccatacaagccgagagcagacagagaagaggaagtggaagcgact
gaggactggtcctctctgattccttcagatggaggagaaactgaagccatggactgctcc
agcagcagaggaagccctgcagacgataaagacaccaccctcaaccagatgcacaacggt
ttctgtgaggacatggaggctgaagaccaagatggcgtgttggtcaccaacaagaactcg
ctcacactgagcatgtctgtggagccgcaggaactctgtcctatagtcctgacggcctgc
aaagcctcgtcttcaggggaacgcatctccagatgtgacatctag

DBGET integrated database retrieval system