KEGG   Danio rerio (zebrafish): 568288Help
Entry
568288            CDS       T01004                                 

Gene name
plce1
Definition
(RefSeq) phospholipase C, epsilon 1 (EC:3.1.4.11)
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    568288 (plce1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    568288 (plce1)
   04070 Phosphatidylinositol signaling system
    568288 (plce1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    568288 (plce1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     568288 (plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
12
AA seq 2248 aa AA seqDB search
MRLHVERQAHIGIKSSMASNRASPVLGVKSLGKETSSNGDARLLMNYSLPGGTPPQTPVH
LEGDSVGTVCRIWKSLDIRSKSLDCLDETFRSKNCSCEAIRHREEGSYNFHMCGFCDSVE
NAEGCPKNTFSPRSWGTVPQKRKAEAFSSGITSLDEPRPTLSGSDGELCPKELVISQNME
NLPFCGLDLRRSSVPVSTPQGPQCANGCGTAENNKMRNRLDFVCAICHKNGFSSLERLNR
NTKPMCSKGKPLKRSKPFRFSVPDSSDGEGTVSDSEFVRNRKDRSTVLVRRYLKNNQKFK
KTVCTGTKAIVKTLPTGCISDRIWESVCNERSRHEASGHSKALQAIQLQVSRALLAYPGA
RLAEIDHAAPTLSPEVSLLHRSRKLLAQAVSWPPVSPSQIRFRACHRRISIAAHLSGALL
VATAALGARTSLPSFTVGSTGRAMLKERQLCSSMANSSILPSAVTGISKELADLRHLIQF
PEEIATILTEQEQQLYRRVFPLDYLSFLTRDLGSPECHKRHPHLKASLSAPIMPTQNDNH
NTVEDLVTRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCSWNMGNYNAVMEFLAGL
RSRKVLKMWQFMDQADIETMRGLKDAMAQHESSSEYKKVVSRALNIPGCKVVPFCGVFLK
ELSEALDGAASIIGLRPSFDSQEDPVEFVTDYNGQQHFLQRLGSDGLHSSDKEATVSNIL
QTIRSCNRSLEAEEPEERAREITVCPKNSFKDKSRNQKGPGTERVLFSIGDLSDSEGDPL
ETVKDVVDLQTTEDVRGPFSHGTELIPWYVLSLQPDIHQFLLQGATVIHYDPESHLTARC
LLRLQPDNCFLTWCKPHSSCSLYGRARTFMGHPASPDHLHIGQPVHCGLSDGLLDLNVVK
AVFMGHPGVDVNYVCLQHKLCNMNPGGNGATLLYGLHTTDNRLLHFVAPKHTARMLHEGL
QELLNSIRKIRKFPDQRLQWLRKQYVSLYQEDGRFEGPTLAHAIELFGGRRWNMGTSGPG
SASRSAEKNSAQKNSPLGINSNVKKKKKALVRGDSGDGTDDEMTARKTRGCKETLGRRES
DPLENVEQGEAEDCSTFSQPGPSSLSNNKGQSPGSSSSSSTSSSVASFCTNSSTPTRPHS
SPILPTNLKSQPGAWSSRSWHGRGKGCFRGFQDLMISDSIMSFVEFVELFKSFSIRSRKD
LKELFDTYAVPCSRSGPESVPLYTTLRIDDKLTGLQPDLDLLTRNGSDLGLFIRTRQQMS
ENQKQISDAIAAASIVTNGTGVENSSLGVLGLAISQLNDFLVNCQREHLSYDEILSIIQK
FEPSSNMRQMGWMSFEGFARFLMDKDNFASKNEESQVNLDELQHPLSYYYIESSHNTYLT
GHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAINRA
AFVNSEMPVILSIENHCSLPQQRKMAEIFKMVFGEKLVTKFLFESDFADEPLLPSPLQLR
GKILLKNKKLKAHQAPVDILKQKAHQLAHMQAQANNGTVSTTPLGNNDEEEEEEDEYDYD
YESLSDDNILDDKPEGKSSTEKLQYESNDEMPKRFKKAGSKGKMFDMELGEEFYLPQNEK
ESRQIAQELSDLVIYCQAIKFPGLSTLSPSGSGRGKDRKSRKSIFGSAPARGSPGEPVTL
VRAPGKASLEGIRMNSEEQMCLSPSTSLSSIIRTPKCYHISSVNENAAKRLCRRYSQKLI
QHTSCQLLRTYPAATRIDSANPNPLIFWLHGVQLVALNYQTDDLPMQLNAALFEANGHCG
FVLKPPVLWDRSCPLYQHFYPLDRDLENMTPTLYTLTIVSGQNVCPGNSNGSPCVEVEVL
GMPADSCHFRTKPIHRNTLNPMWNEHFQFHVHFEDLAFLRIAVVENNSSQVTAQRILPLK
TLRAGYRHLQLRNLHNEPLEVSSLFMFSRRTEESPTGGPPSASVLFSTEERRSVQQHKVT
VHGVPGPEPFTVICVDEFTTAKQLLDSLFPTASFKYMLMEERVSLSKEKKAPQQRPLAND
ERLLKLIHSWQPEDGYVGRIYLKTREQQNCSEKTSVPLESLEELGSSEDDTFFVQVHDVS
PEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSILSNPNPCDYVLMEELCKDAGGKKSSSA
KPCQRVLQDHECVFQAQSRWKGAGKFILKLKEQLAREDKRKGVSFASELRKLTGRSRSVT
VNTNSNDTHSKEEKSACPSMSCVPETSQ
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcatgttgagagacaagcgcatattggcatcaagagctccatggcctccaat
agggcttcgcctgtgctgggagtgaagagtcttggtaaggagacttcaagtaatggagat
gctcgtttattaatgaactacagtttgcctgggggcacaccccctcagacaccagtacat
ttggagggggactcagtgggcacagtgtgcagaatatggaagtctttggatatcaggtct
aagagtttggattgcttagatgagaccttcaggtccaaaaactgcagctgtgaggctata
aggcacagggaagaaggatcctacaatttccatatgtgtgggttttgcgattcagtggaa
aatgcagaaggctgcccgaagaatactttttctccwagaagctggggaacggttccccaa
aagaggaaagcagaagctttttcttctggtattacttcccttgatgaacctcgaccaaca
ttgagtggctcagatggggaactgtgcccaaaggaattagtcatcagccaaaacatggag
aacctgcctttctgtgggttggatttgaggagaagcagtgtgccagtatccacaccacaa
ggccctcaatgcgccaacggttgcggcactgccgagaataataagatgcgaaacagactg
gactttgtgtgtgccatatgccataaaaatggattctctagcctagaaaggcttaacaga
aacaccaaacccatgtgctctaagggtaagccccttaagaggtccaaacccttcaggttc
tctgtacctgacagtagtgatggcgagggcaccgtatccgacagcgagtttgtgcgtaac
aggaaagatcgatctactgtgctggtcaggagatatctcaagaacaaccagaaatttaaa
aagaccgtgtgcacaggcactaaagctatagtgaagactctacccaccggctgcatctct
gacaggatctgggagtctgtgtgcaatgagaggagcaggcatgaggcgagcggacacagc
aaagcgcttcaggccatccagctgcaggtttccagggcccttctcgcctatcccggggcc
aggcttgcagagattgatcatgctgctcctactttgagtcctgaagtcagtctcctgcac
agatccaggaagctgctggcccaggcggtgtcatggccgccggtctcaccgtcgcagatt
agatttcgggcttgtcatcgcagaatcagcattgcagcccatctgagcggggccctgctg
gtggccacagctgctcttggggcccgcacttctctgcccagcttcactgttggctccaca
ggacgagcaatgctgaaagaacggcagctgtgcagctccatggccaactccagcatcctg
ccatctgccgtgacggggatcagtaaggaactagctgacctgcgccacctcatccagttt
ccagaggaaatcgccaccatcctgacagaacaggagcagcagctataccgccgcgtcttc
ccgctcgactacctcagctttctcacccgagacctgggcagcccagagtgccacaaacgc
cacccgcatctaaaagcttccctgtcagcccccatcatgcccactcagaatgacaaccac
aacacagttgaagacctcgtcacaagattcaatgaggtgagctcatgggtgacctggctt
atcctgacggcgggctccatggaggagaagagggaggttttctcgtacctcgtccatgtg
gccaagtgctcgtggaacatgggcaactacaacgcggtcatggagttcttggcaggcctc
aggtcccgcaaagtgctgaagatgtggcagtttatggaccaggcagatattgagaccatg
cgaggtctaaaggatgccatggcccagcacgaatcatcatctgagtacaagaaagtcgtc
agccgtgccctcaatatcccaggatgcaaagtggtgcctttctgtggcgtgttcctcaag
gagctgagtgaggctctggatggcgcagccagcattattggactgcgtccgtcttttgat
tctcaagaagatcctgttgagtttgtcacggactacaacggccagcagcactttctgcaa
aggcttggaagtgatggacttcacagctcagataaagaggcgaccgtcagtaacatactg
cagaccatccgcagctgcaaccgaagcctggaggccgaggagcctgaggagagggcacga
gagatcaccgtttgccccaaaaattcctttaaagacaagagcagaaaccagaaaggacct
gggactgaacgagtcctgttttcaatcggcgacctctcagactctgaaggggacccactt
gagacagttaaggatgttgtagacctccagaccaccgaagatgttcgcggaccctttagc
catgggacagagctcattccctggtacgttctgtcgcttcagccggatatccatcagttc
ctgctccaaggagcaaccgtcatccactacgaccccgagagccacctcaccgcccgatgt
cttctccgtctacagcccgataactgcttcctcacctggtgcaaaccccacagtagctgc
agcctatatggaagagctagaaccttcatgggacatccagcatccccagaccacttacac
atcggccaacctgttcactgtggactctctgacgggctcctggatcttaatgtggtgaag
gctgtgtttatgggtcaccctggagtggacgtcaactatgtctgcctgcagcacaaactg
tgtaacatgaatcctggtggaaatggtgccacgctgctatatggacttcacaccacagac
aacaggctcctgcactttgtggccccgaaacacacggctcgcatgctgcacgagggcctc
caggagctgctgaactctatcaggaagatcaggaaattccctgaccagagactgcaatgg
ctgagaaagcaatatgttagtttgtaccaggaggatggtagatttgaaggacctacactg
gctcatgctatcgagctgttcggagggagacgctggaatatgggaactagcggcccagga
tccgccagcagaagtgcagagaagaactcggctcagaaaaacagtccactgggcatcaac
tccaatgtcaaaaagaagaaaaaggccttagtcaggggggacagtggcgatggaactgat
gatgagatgaccgcacgcaagaccaggggttgcaaagagactttggggaggagagagtca
gatcctctggaaaatgttgagcagggagaggctgaggactgcagtacctttagccaacct
ggaccatcttccttatccaacaacaaaggccagtctccgggatcctcctcgtcctcctcc
acctcttcttctgttgcctccttttgcacaaactcctccacccctacacgtccacattcc
tccccgatcctccccacaaacctcaagagtcagccaggggcctggagcagtcgaagctgg
cacggtcgagggaaaggctgcttcagaggtttccaggacctcatgatctccgacagcatc
atgagctttgtcgaatttgtggagctcttcaaatcttttagcattcgcagtcgtaaggat
ctgaaggaactattcgacacctacgccgtgccctgcagtcgctctggccctgagtctgtc
cccctctacaccacacttaggattgacgacaagctaaccggactgcagccagatctggat
ctcctcactcgcaacggctctgacctgggccttttcattcgcacccgccagcaaatgtct
gaaaaccagaagcagatttcagacgccatcgcagctgccagtattgtgaccaatggcact
ggagtggagaattcatcgctgggtgtgctgggactggccatctcgcagctcaatgatttc
ttggtcaactgtcagagagaacatctgagctatgatgagatcctcagcatcatacagaaa
tttgagccttcttcaaacatgcgtcagatggggtggatgtcgtttgaaggattcgccagg
tttctaatggacaaggacaactttgcctccaaaaatgaggagtctcaagtgaacctggat
gagctccagcatccgctgtcttactattacatcgagtcctctcataacacatacctgacg
gggcatcagctgaagggagagtcttcagtcgagctctacagccaggtgttgctgcagggt
tgtcgcagcgttgagttggactgctgggatggggatgacggcatgcctgttatttaccat
ggacatactcttaccactaagattcctttcaaggatgttgtagaggccatcaaccgtgca
gcatttgtgaactcagagatgcctgtgattctgtccattgaaaaccactgctccttacca
cagcagcgcaaaatggctgagatttttaagatggtgtttggtgagaagctggtgaccaag
tttytgtttgaaagygatttcgcggacgagcctttgcttccgtctccccttcagctccgg
gggaaaatcctcctgaagaataaaaagttaaaagctcaccaggctcctgttgacattctc
aaacaaaaggcgcatcagcttgcccacatgcaggctcaggccaacaacggcacagtcagc
acaacgccactgggaaacaatgatgaagaggaggaggaggaagacgagtacgattacgat
tacgagtcgctgtctgacgacaatattctggatgacaaacctgaaggcaagtcatctacg
gagaaacttcagtacgagtccaacgatgagatgccaaagcggtttaaaaaagctggaagc
aaaggaaagatgtttgacatggagctgggagaggagttttacctgccccagaacgagaag
gagagtagacagattgctcaagagctgtcagatctggtcatctactgccaggccattaaa
tttccaggcctctccaccctctctccatcaggctctggaagggggaaagacagaaagagc
cggaaatccatctttggcagcgctcctgctcgcgggagccccggggagcctgtgacgctg
gtccgagctccagggaaagccagtcttgagggcattcgcatgaactcggaggagcaaatg
tgtctgagcccgagcacctctctgagctccatcatccgcacgcccaaatgctaccacatc
tcctctgtgaacgagaatgcagcgaagcgcttgtgtcgccgctactcgcagaagctcatc
cagcacaccagctgccagctgctgcgcacgtacccggcggccacacgcattgactctgcc
aaccccaatccgctcatcttctggctgcacggagtccagctggtggccctcaactaccag
actgatgatctgccgatgcagctgaacgcggctctattcgaggctaatggtcactgtggt
tttgtgctgaagcctccagtcctgtgggacagaagctgtcctctctatcagcacttttac
cctctggaccgagacctggagaacatgaccccaacgctatacacactcactattgtgtcg
gggcagaacgtgtgtccaggaaactcaaacggcagtccgtgtgtcgaagtggaggtgttg
ggaatgccggcggacagctgtcatttccgaactaaacccatacaccgcaacacactcaat
cccatgtggaacgaacacttccagttccacgtgcactttgaagacctggcattcctgcgc
atcgctgtggtggagaacaacagctctcaggtcaccgctcagaggatacttcccctcaaa
acactcagagcaggctaccggcacctgcagctgaggaacctgcacaacgagcctctggag
gtgtccagtctgttcatgttcagccgcaggacggaggagagcccgactggaggaccaccg
tctgcgtctgtgctgttcagcaccgaggagagacgatctgtgcagcagcacaaggtgacc
gtgcatggagtccccggacctgaacccttcactgtgatctgtgtcgatgaattcaccaca
gccaaacagctcctggactctctgtttccgactgcctcctttaagtatatgctgatggag
gagagagtgtctctgtcgaaggagaagaaggctcctcagcagcgtcctttagccaatgat
gagagacttctgaagctcattcacagctggcagcctgaggacggatatgtgggcagaata
tacctcaaaaccagagaacagcagaactgcagtgagaagacgagcgtcccgctggagtca
ctggaggagctcggcagctcagaggacgacaccttcttcgtgcaggtccatgatgtttct
ccagaacagcctcacaccgtcatcaaagccccgcgatacagcacagcacaggacatcatc
cagcagactctgagcaaagccaagtattctctgagtatcctgagcaaccccaacccatgt
gactacgtcctgatggaggagctttgtaaagacgcgggtggaaagaagtcgtcctctgcc
aaaccgtgccagcgtgtgctgcaggaccacgagtgtgtgtttcaggctcagagccgctgg
aagggggctggaaaattcatcctcaaactcaaagagcagttggctcgtgaggacaagcgt
aaaggtgtgtcgttcgccagtgagctgaggaagctgacgggtcgcagtcgcagtgtgacg
gtcaacacaaacagcaacgacactcacagtaaggaagagaagagcgcatgtcccagcatg
agctgtgtgccggagacatcgcagtga

DBGET integrated database retrieval system