KEGG   Danio rerio (zebrafish): 568298Help
Entry
568298            CDS       T01004                                 

Gene name
pom121, wu:fa16c07, wu:fl35g12
Definition
POM121 transmembrane nucleoporin
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    568298 (pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 1201 aa AA seqDB search
MSPEDKRRLVVFSAVVFSLFILLLVLSYIPAYLYILFICVVSCVVYFHKAEELQLFERLG
LNPRRGLSVPPALLRWLPGRTFSGVPAAGRNKIRKSDARTSFASPSDRHFVGSYYRREQL
SESVFSPRDILMGSYLAKPEESPSAAVRPAGGSGSFMHPREQLRERLARPNHAVHTPNRR
LSFGDPAGNASRFTITPQRHYPLQQTGTSPIGVMPPAKWDGYRKKNILTQRNSPTVHSPV
TVKIARPDSTRSSFFNHLNSPGAVTSPGIGAQADPCSREAVLSVLRESRKREVDEEDKSA
SSGQKSKRRRHDSSGSSQSAFEPLLANGAPSQLVPKPGSLKRGMNSSLIEESIMKRSRTS
SVSSISGAPVPSGVPGSVRNPIRSSYSSSQGYPQRRAASSLSLSPFTSPGGSRCQTPERA
AKKAREEDATSPSSTSFAKTDKVAADPDPSPNTTKLTPKSEAPVATSTSDSGSSGGKRKR
KIQLVTTNRGDQISLPPPPEVGYTITVKDLDMEKKAALSKIQKVLEEPEPEIPPPASEPA
PAPVSAPTLSLFSQPAPISTSGTAPATSVVPSLLSLSTPKPETTPAITTTPAPTIDLTIT
ASSTASSAPLTLISSPAITTASLTAATTVSTAPASSISNPLLESLKNMKNNPLLTAPTLM
GTTTAAPAVPVSSLSAPAASIIPSSGVVKSESGPTALQSSFSAPSSISSPAFKPATSMPS
TFAQILAQPLQPPSTISSLGGGSSLFSLIKPVATPASEPPKSTVAAPTNTAASVNSISNP
LSSGFKPIFSAASTTPASTPEVKPTQPTFKPLFGSTTISGVSAFGQTITPTTSTPAAPAS
QNSAMLFGGLTSTQPTTVPSSAAPATQTPSQSLFGKWSTPTTSAPATNPTFQFGATSTTT
ATPALNTNTASVGSANSAFQFGAAKPAAAPQAQNTFTFGQQSTNQNSTTTPFGGFGVTSN
ATTSSEAPTTQTTFGSSTFTTSSNFPASTPQALAAPKPFAFGAAGASSGASPFTFGTAAS
TSAPAFGTNSQPAFGGVSSGFSFGNTTTPSATPVFGATTQTAAPAPAPAPTFTFGGAPTA
NQNTAPSTPAPPASGGFNFGASLSSTPFGTPAPAAQPQGFSFGANNTDSKPAFGTSTPAF
GQASPGMSMPFGSPGTPGFGAMGGLGASPFGASPASFSIGTGTKTSGARRLQARRQHPRK
K
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagaagataaacggcggctagtcgttttctccgctgtggtcttctctctcttc
attcttttactcgttttgagctacataccagcttatttgtacatactttttatctgtgtc
gtgtcttgtgtcgtttattttcataaagcggaggagttacagctcttcgagagactaggc
ctcaatccacgccgtggcctgagcgtcccgccggctctgctgcgctggttgccgggcagg
acttttagcggtgtcccggccgccggcagaaacaagatacgcaaaagtgatgctagaacc
tctttcgcgtcacccagcgatagacactttgtgggctcgtactatagaagagagcagctc
agtgagtcggtgttcagccctcgggatatactcatgggaagttacctcgccaagcccgaa
gaaagcccctccgccgcggtgaggcccgccgggggatcggggtctttcatgcaccccaga
gaacagctccgggagagactcgcccgacccaatcatgccgttcacacccctaacagaaga
ctgtcattcggggaccctgcaggaaatgcgagccggttcaccatcaccccccagagacat
tacccccttcaacagacaggcacatctcccattggagtcatgccaccggcaaaatgggat
ggataccgtaagaagaatatcctcacccaacgcaattcacctactgttcacagtccagtc
acggtgaagatcgccagaccagactccactcggtcatcattctttaatcacctgaactcc
cctggagccgtcacctctcctgggattggagcacaggctgacccctgctccagagaggct
gtcctgagcgtgctcagagagagcaggaagagagaggttgatgaggaggacaagagtgct
tcctcagggcagaagagcaaaaggaggcgacatgacagcagtggaagttctcagtcagcg
tttgagcctcttcttgcaaatggagctccgtctcagctcgtgccaaaacctggcagtctg
aagagaggcatgaactcttctctcattgaagagtccatcatgaagcggtctcgcacctcc
tctgtcagctctataagtggtgctcctgttcccagtggtgtacctggatctgtccgaaat
cccattcgcagttcctacagctcctcacagggttatccacagagacgagcagcatccagt
ctcagtctttctcccttcacaagcccaggaggatctcggtgtcagactccagagcgagct
gccaagaaagcaagggaggaagatgctacctcaccaagttcaacatccttcgctaaaacg
gataaggtggcagctgatcctgacccttctccaaatacaactaaacttaccccaaaatct
gaggcacctgttgcgacatcaacgtcagactctggaagcagcggtggcaaacgtaaacgc
aaaattcagctggtcaccacaaacagaggagatcagatttctttgccaccacctcctgag
gttggatatacaatcacagtgaaagatctagatatggagaagaaagccgctctcagcaag
atacagaaagtcctggaggagcctgaaccggagattcctcctccagcatctgaacctgct
cctgccccagtttcagctcccactttatccctgttctctcagccagctccaatctccaca
tccgggacagcacctgctacgagcgttgttccctctctgctttctctctccacacccaag
cctgagaccacaccagctattactacaactcctgctccaactattgacctaaccatcact
gcgtccagcacggccagctctgcacctctaaccctcatctcatcccccgccatcactacc
gcatctctaacagctgccacaactgtttcaactgcaccagcttcaagcatttcaaacccc
ctgctggagtctctgaaaaacatgaagaataatcctcttctcactgctccgactctgatg
ggcactaccactgcagctccagcagtgcctgtatccagtctttctgctcctgctgcatcc
ataatcccaagcagtggagttgtcaagtctgaatcgggtcccactgctctgcaatcctca
ttctctgccccatcctccatatcatcacctgctttcaaaccagccacctccatgccctcc
acctttgctcagatcctggcccaacctcttcagcccccatcaaccatttcatcgctgggt
ggaggcagcagcctgtttagcttgatcaaacctgtggccacacctgcatctgagcctccc
aagtctacagttgccgcacctacaaacacagctgcatcagtcaacagcattagcaatcct
ctctcatctgggtttaagcccattttcagtgcagcaagcaccacccctgcttcaacaccc
gaggtcaaacccacccagcccaccttcaagcctttatttggcagcaccacaattagtggc
gttagtgcattcgggcagaccatcacaccgacaacatcaacccctgcagctccagcctca
cagaacagtgcgatgttatttggtggattaaccagtacccagccaacaacagtgccctct
tctgccgccccggccacacagactccctcccagtctctgtttggaaaatggtccacacca
accacatctgctcctgccacaaaccccacgttccagtttggagctacatcaactactacg
gcaacacctgcgctgaacaccaacactgctagcgttggcagcgctaactccgcttttcaa
tttggtgcagcaaaaccagctgccgccccacaggcccaaaacacgttcacatttggccag
cagtccacgaaccagaactccacaacaactccatttggtggattcggtgtgaccagcaat
gccaccacgtcctcagaagcgcccacaacacaaaccacatttggaagctcgactttcacc
acatcatccaatttcccagcatccacaccgcaggccctcgctgctccaaagcctttcgca
tttggagccgccggcgcaagcagcggtgcatcaccgttcacatttggcaccgctgccagc
acatcagcacctgcatttgggactaatagtcagcctgcatttggtggagtgtcatccggc
ttttctttcggaaacaccaccacaccttctgcaacacctgtctttggggccaccacacag
actgcggcccctgcacctgccccagcacctacgttcacctttggaggggcaccaacagcc
aatcagaacactgcaccaagtactccggctcctcctgcctctggagggtttaactttggg
gcgtcactttcatcaacaccatttgggacccctgcgcctgcagctcaaccccaagggttt
tcttttggagccaataacactgacagcaagcctgcttttggaacatcgactcctgctttt
ggccaggcgtctccaggaatgtccatgccattcggcagtcctggaacaccaggatttgga
gcaatgggcggcttgggtgcttcaccatttggtgcttcaccagccagcttctctattggg
acgggtactaaaacctctggggctcgtcgattacaagcacgcaggcaacacccacggaag
aagtaa

DBGET integrated database retrieval system