KEGG   Danio rerio (zebrafish): 568298Help
Entry
568298            CDS       T01004                                 

Gene name
pom121
Definition
(RefSeq) nuclear envelope pore membrane protein POM 121
  KO
K14316  
nuclear pore complex protein Nup121
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    568298 (pom121)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     568298 (pom121)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
10
AA seq 1201 aa AA seqDB search
MSPEDKRRLVVFSAVVFSLFILLLVLSYIPAYLYILFICVVSCVVYFHKAEELQLFERLG
LNPRRGLSVPPALLRWLPGRTFSGVPAAGRNKIRKSDARTSFASPSDRHFVGSYYRREQL
SESVFSPRDILMGSYLAKPEESPSAAVRPAGGSGSFMHPREQLRERLARPNHAVHTPNRR
LSFGDPAGNASRFTITPQRHYPLQQTGTSPIGVMPPAKWDGYRKKNILTQRNSPTVHSPV
TVKIARPDSTRSSFFNHLNSPGAVTSPGIGAQADPCSREAVLSVLRESRKREVDEEDKSA
SSGQKSKRRRHDSSGSSQSAFEPLLANGAPSQLVPKPGSLKRGMNSSLIEESIMKRSRTS
SVSSISGAPVPSGVPGSVRNPIRSSYSSSQGYPQRRAASSLSLSPFTSPGGSRCQTPERA
AKKAREEDATSPSSTSFAKTDKVAADPDPSPNTTKLTPKSEAPVATSTSDSGSSGGKRKR
KIQLVTTNRGDQISLPPPPEVGYTITVKDLDMEKKAALSKIQKVLEEPEPEIPPPASEPA
PAPVSAPTLSLFSQPAPISTSGTAPATSVVPSLLSLSTPKPETTPAITTTPAPTIDLTIT
ASSTASSAPLTLISSPAITTASLTAATTVSTAPASSISNPLLESLKNMKNNPLLTAPTLM
GTTTAAPAVPVSSLSAPAASIIPSSGVVKSESGPTALQSSFSAPSSISSPAFKPATSMPS
TFAQILAQPLQPPSTISSLGGGSSLFSLIKPVATPASEPPKSTVAAPTNTAASVNSISNP
LSSGFKPIFSAASTTPASTPEVKPTQPTFKPLFGSTTISGVSAFGQTITPTTSTPAAPAS
QNSAMLFGGLTSTQPTTVPSSAAPATQTPSQSLFGKWSTPTTSAPATNPTFQFGATSTTT
ATPALNTNTASVGSANSAFQFGAAKPAAAPQAQNTFTFGQQSTNQNSTTTPFGGFGVTSN
ATTSSEAPTTQTTFGSSTFTTSSNFPASTPQALAAPKPFAFGAAGASSGASPFTFGTAAS
TSAPAFGTNSQPAFGGVSSGFSFGNTTTPSATPVFGATTQTAAPAPAPAPTFTFGGAPTA
NQNTAPSTPAPPASGGFNFGASLSSTPFGTPAPAAQPQGFSFGANNTDSKPAFGTSTPAF
GQASPGMSMPFGSPGTPGFGAMGGLGASPFGASPASFSIGTGTKTSGARRLQARRQHPRK
K
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagaagataaacggcggctagtcgttttctccgctgtggtcttctctctcttc
attcttttactcgttttgagctacataccagcttatttgtacatactttttatctgtgtc
gtgtcttgtgtcgtttattttcataaagcggaggagttacagctcttcgagagactaggc
ctcaatccacgccgtggcctgagcgtcccgccggctctgctgcgctggttgccgggcagg
acttttagcggtgtcccggccgccggcagaaacaagatacgcaaaagtgatgctagaacc
tctttcgcgtcacccagcgatagacactttgtgggctcgtactatagaagagagcagctc
agtgagtcggtgttcagccctcgggatatactcatgggaagttacctcgccaagcccgaa
gaaagcccctccgccgcggtgaggcccgccgggggatcggggtctttcatgcaccccaga
gaacagctccgggagagactcgcccgacccaatcatgccgttcacacccctaacagaaga
ctgtcattcggggaccctgcaggaaatgcgagccggttcaccatcaccccccagagacat
tacccccttcaacagacaggcacatctcccattggagtcatgccaccggcaaaatgggat
ggataccgtaagaagaatatcctcacccaacgcaattcacctactgttcacagtccagtc
acggtgaagatcgccagaccagactccactcggtcatcattctttaatcacctgaactcc
cctggagccgtcacctctcctgggattggagcacaggctgacccctgctccagagaggct
gtcctgagcgtgctcagagagagcaggaagagagaggttgatgaggaggacaagagtgct
tcctcagggcagaagagcaaaaggaggcgacatgacagcagtggaagttctcagtcagcg
tttgagcctcttcttgcaaatggagctccgtctcagctcgtgccaaaacctggcagtctg
aagagaggcatgaactcttctctcattgaagagtccatcatgaagcggtctcgcacctcc
tctgtcagctctataagtggtgctcctgttcccagtggtgtacctggatctgtccgaaat
cccattcgcagttcctacagctcctcacagggttatccacagagacgagcagcatccagt
ctcagtctttctcccttcacaagcccaggaggatctcggtgtcagactccagagcgagct
gccaagaaagcaagggaggaagatgctacctcaccaagttcaacatccttcgctaaaacg
gataaggtggcagctgatcctgacccttctccaaatacaactaaacttaccccaaaatct
gaggcacctgttgcgacatcaacgtcagactctggaagcagcggtggcaaacgtaaacgc
aaaattcagctggtcaccacaaacagaggagatcagatttctttgccaccacctcctgag
gttggatatacaatcacagtgaaagatctagatatggagaagaaagccgctctcagcaag
atacagaaagtcctggaggagcctgaaccggagattcctcctccagcatctgaacctgct
cctgccccagtttcagctcccactttatccctgttctctcagccagctccaatctccaca
tccgggacagcacctgctacgagcgttgttccctctctgctttctctctccacacccaag
cctgagaccacaccagctattactacaactcctgctccaactattgacctaaccatcact
gcgtccagcacggccagctctgcacctctaaccctcatctcatcccccgccatcactacc
gcatctctaacagctgccacaactgtttcaactgcaccagcttcaagcatttcaaacccc
ctgctggagtctctgaaaaacatgaagaataatcctcttctcactgctccgactctgatg
ggcactaccactgcagctccagcagtgcctgtatccagtctttctgctcctgctgcatcc
ataatcccaagcagtggagttgtcaagtctgaatcgggtcccactgctctgcaatcctca
ttctctgccccatcctccatatcatcacctgctttcaaaccagccacctccatgccctcc
acctttgctcagatcctggcccaacctcttcagcccccatcaaccatttcatcgctgggt
ggaggcagcagcctgtttagcttgatcaaacctgtggccacacctgcatctgagcctccc
aagtctacagttgccgcacctacaaacacagctgcatcagtcaacagcattagcaatcct
ctctcatctgggtttaagcccattttcagtgcagcaagcaccacccctgcttcaacaccc
gaggtcaaacccacccagcccaccttcaagcctttatttggcagcaccacaattagtggc
gttagtgcattcgggcagaccatcacaccgacaacatcaacccctgcagctccagcctca
cagaacagtgcgatgttatttggtggattaaccagtacccagccaacaacagtgccctct
tctgccgccccggccacacagactccctcccagtctctgtttggaaaatggtccacacca
accacatctgctcctgccacaaaccccacgttccagtttggagctacatcaactactacg
gcaacacctgcgctgaacaccaacactgctagcgttggcagcgctaactccgcttttcaa
tttggtgcagcaaaaccagctgccgccccacaggcccaaaacacgttcacatttggccag
cagtccacgaaccagaactccacaacaactccatttggtggattcggtgtgaccagcaat
gccaccacgtcctcagaagcgcccacaacacaaaccacatttggaagctcgactttcacc
acatcatccaatttcccagcatccacaccgcaggccctcgctgctccaaagcctttcgca
tttggagccgccggcgcaagcagcggtgcatcaccgttcacatttggcaccgctgccagc
acatcagcacctgcatttgggactaatagtcagcctgcatttggtggagtgtcatccggc
ttttctttcggaaacaccaccacaccttctgcaacacctgtctttggggccaccacacag
actgcggcccctgcacctgccccagcacctacgttcacctttggaggggcaccaacagcc
aatcagaacactgcaccaagtactccggctcctcctgcctctggagggtttaactttggg
gcgtcactttcatcaacaccatttgggacccctgcgcctgcagctcaaccccaagggttt
tcttttggagccaataacactgacagcaagcctgcttttggaacatcgactcctgctttt
ggccaggcgtctccaggaatgtccatgccattcggcagtcctggaacaccaggatttgga
gcaatgggcggcttgggtgcttcaccatttggtgcttcaccagccagcttctctattggg
acgggtactaaaacctctggggctcgtcgattacaagcacgcaggcaacacccacggaag
aagtaa

DBGET integrated database retrieval system