KEGG   Danio rerio (zebrafish): 568510Help
Entry
568510            CDS       T01004                                 

Gene name
gtf3c4, im:7138272, si:dkeyp-10e10.3
Definition
general transcription factor IIIC, polypeptide 4
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     568510 (gtf3c4)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     568510 (gtf3c4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
21
AA seq 770 aa AA seqDB search
MAALRSNSSSEKAGTASEAPSGPEDDFWAGQGPIVLRDPAIKLLSPVSGVEPLSWAEDHR
LAACNTNSVSLMELVCDIHSLSQNLVLHRTHIPVPTTTCELKVGSEKDVRAVKESFANSK
DPVVSQMIMIDRVINPQCGPLHGVKYTSWSPLGCDKLGRCLLAFLTLDNRLTIHSSHLQL
QWTLLLDLTELYGEMLKTRKYSAQNDGTPPVSFKDFDELQRRFRMQTPVRMEWSSLCSMQ
QVQSDNAHKDINTVLLAVLMENGDVVVWQFSLPLNGKESVVSCSTIKSGVSSPSALTWWQ
YEHGGRKMSGLIIGSSVGPVKILPVNIKAVKGYFTLRQPVVLWQESDQIPVHNIKCITLF
HPHQKCNCSLVVAARGPYIFWCLLLISKAGLNVHNSHITGLHSTPIISMTACHNNGTVLT
CSLDGKVKKLTTVFTDLAVEFKQEEIVLPEGVAGRRIHGISISPNSAYLAVLSNEGMNNG
FHPVALNYQVQFITFKTPDEAAAKMLDAHCLFRNSDLLDLLRWRILKDKSIPSAYENNLE
EKLQTSGSTYLWRLKLFFLRTLHKSMQKTPSEALWQPRRRSGQSLVGDGDEGGGGDEDEM
MEDRQGDAEIREREERMKEIGSRIEAVESHLIRENMKKVLGEVYLHTCVTQNTRVPTKGV
CDFLTNDPANEDRAAKVLIGHIMNKMNKQTFPEYCALCKETLPFTDCKRAECKNGHRWLR
CALSYQACQGVTYRRCLLQDSIASVAEPEDSDWIKKILQGPCIFCDSPFY
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttacgctcaaacagttcttcagagaaagcagggaccgcgtctgaagccccg
tcaggaccggaggatgatttttgggcgggacagggaccaatagtgctgcgggatcctgcg
attaaattgttgagtccggttagcggtgtggagccgctgtcgtgggcagaagatcacaga
ctggcggcctgcaacacgaacagcgtgtctctgatggagctggtgtgtgacatacacagt
ctcagtcaaaacctggtgctgcatcgcactcacatccccgtccccaccaccacatgtgaa
ctcaaggtgggctcagaaaaagatgtgagggctgttaaagaaagctttgccaatagtaaa
gacccagtagtaagccaaatgatcatgatagaccgagtcatcaatcctcaatgtggacct
ctccatggcgtcaagtacactagttggtcaccgttaggctgtgacaaactcggccgctgc
cttcttgctttcctaacacttgacaatcgtctcacaatccacagcagtcacttgcaactg
cagtggacgctactgctggaccttacagaactatatggcgaaatgttaaaaaccaggaaa
tactccgctcagaatgatggcacaccaccggtctcctttaaagacttcgatgaactgcag
cgtcggtttcgtatgcagacaccagtgcgcatggagtggtccagtttgtgcagtatgcag
caagttcagagcgataacgctcataaagatatcaacacagttcttctagctgtactcatg
gagaatggagacgtggtggtgtggcagttcagcttgcccctaaacggaaaggaatcagtg
gtgtcatgcagcaccatcaaatctggtgtgtcgtcaccaagcgcgctcacctggtggcaa
tatgagcacggcgggcggaaaatgagcggactgatcatagggagctccgtaggacctgta
aagatcctcccagtcaacattaaggcagtgaagggttacttcaccctcaggcagcctgtg
gttttgtggcaggagagcgaccagattcctgtccacaacatcaaatgcatcacactcttc
catccgcaccagaaatgcaactgcagtttagtggttgcggcacgtggtccgtatatcttc
tggtgcttactgctgatctccaaagctggtctgaatgttcacaattcccacatcacgggt
cttcattccacccctatcatatccatgacggcttgccacaataatgggactgttttaaca
tgctcactagatgggaaggttaagaagctaacgactgttttcacagacctagctgtcgag
ttcaagcaagaagagattgttctgcctgaaggagtcgcgggtcgacggatacacggtata
tcaatcagtccaaacagtgcctacttggctgttctctccaatgagggtatgaacaatggc
ttccatcctgtcgctctcaactaccaggtacagttcatcacctttaagactccagatgaa
gcggcagctaagatgcttgatgctcactgtctctttagaaactctgatttgctggatttg
ttacgatggcggatactaaaagacaaaagcatcccttcggcctacgagaataatctagaa
gagaagctgcaaacctcagggtccacttacctgtggcgtcttaagcttttctttctcaga
acgcttcacaagtccatgcagaaaactccttcagaggctctgtggcagccaaggcgaaga
agtggtcagagtttagttggtgatggtgatgaagggggtggaggtgatgaagatgagatg
atggaggacagacagggggatgcagaaattagggaaagagaggagagaatgaaagagatt
ggcagcaggatcgaagctgtggagtcccatctgatccgggagaacatgaagaaggtgctg
ggcgaggtgtatctgcacacctgtgtcactcaaaacacacgtgtacccactaaaggtgtg
tgtgacttcctcacaaatgaccctgctaatgaagacagggcagccaaggtgctgataggt
catatcatgaataagatgaataaacagacatttccagagtattgcgctctctgtaaagaa
actctgcccttcaccgactgcaagcgggcagagtgcaagaatggacacaggtggctcagg
tgtgcgctgtcatatcaggcctgtcagggtgtgacataccgccgctgtctattgcaggac
agtattgcctcagtagcagagcctgaggattcagactggatcaagaaaatcctccaaggt
ccctgcatcttctgcgattctcctttctactga

DBGET integrated database retrieval system