KEGG   Danio rerio (zebrafish): 568618Help
Entry
568618            CDS       T01004                                 

Definition
si:dkey-110c1.7
Orthology
K15293  
protein unc-13
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
22
AA seq 1742 aa AA seqDB search
MFISYLHTRLSVTVKKAKLDGPQEKFNTYVSLKVQNVKSTTIAVRGSQPCWEQDFMFEIN
RLDLGLTVEVWNKGLIWDTMVGTLWIPLSSIRQSNEEGPGQWLTLDAQVIMAENEICGTK
DPTFHRVLLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDYTFQEEHERPLPMPSTQCC
NWSLWGDQQNDDPDSAVDDRDSDYRSETSNSIPPPFYTTSQPNASMHQYPIRQMQHGSRY
NEMHDYDYDNQRAISPTGSSRYASSGELSRGSSQLSEEFGPEDGESFRGSGEFYDENDSY
HSCHSSVSYGKESPGWDPDEPQGVYSDDGEYNKDGGEEGALYDEEGEIYEQDEGEYPYEE
EEEGMVYEEDEDLYPLDGTLSEEQEPPYTPTPTSTAPTLAPDALTSRPPLEKQASMHQQQ
PSQSQIPFQPMEPKRESPPPQQTHDVFAKVPRTTTPPQISDTEPEKVPTPPGNGPAYAED
LLSTSTTEIPPKAEQEKKEALPERAKANWLRLFNRVRLQLQEARGETPGLASLFLQAGPG
GALYSIDSMPDLRKRKAIPLVRDLSLVQNSRKAGITSAMASSTLNNEELKSHVYKKTLQA
LIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLNADC
LQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQDVFAVIKATHVAQMKQI
KQSVLDGTSKWSAKISITVLCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNLNPVW
DESFNFECHNSSDRIKVRVWDEDDDIKSRVKQKFKRESDDFLGQTIIEVRTLSGEMDVWY
NLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTCLHENLFHYLTDIQNNGVVKIPD
AKGDDAWKVYFEETPQEIVDEFAMRYGVESIYQAMTHFACLSSKYMCPGVPAVMSTLLAN
INAYYAHTTQATNNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSMYRNNFPASSPER
LQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHELYSRE
YQTDPNKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKI
SAEVMWNLFAQDMKYAMEEHEKNRLCKSADYMNLHFKVKWLYNEYCKDLPFFKSRVPEYP
TWFEPFVIQWLDENEEVSRDFLHGALERDKKDGYQQTSEHALFSCSVVDVFSQLNQSFEI
IKKLECPDPQIVGHYMKRFAKTISNVLLSYADIISRDFPNHCTKEKVVIPCILINNIQQL
RVQLEKMFEAMGGKDLNVEASDILKELQLKLNNVLDDLARIFATSFQPNIEENVKQMGDI
LSQVKGTGNVPASACSSVAQDADNVLQPIMDFLDSNLTLFAKICEKTVLKRVLKELWKLV
MNTMEKTIVLPPLTDQTGRVKLACHSDGTQLIFNAAKELGQLSKLKEHMVREEAKALSPK
QCAVIELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLHYALSLYTQATDKLIKTFVQSQN
TQGTGVDDAVGEVSIHVEIFTHPNTGEHKVTVKVVAANDLRWQTSGIFRPFVEVYIIGPH
LSDKKRKYATKSKNNSWAPKYNETFTFTLSNEVGPECYELQVCVKDYCFAREDRTVGMAV
LQLKDVAPRGSVACWLPLGKRIHMDETGLTVLRILSQRNNDDVAKEFVKLKSDQRSAEEG
RS
NT seq 5229 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctcttatttacatacacgtctctctgttacagtgaagaaagccaagctcgat
ggaccacaagagaaattcaacacctacgtgtcactgaaggttcaaaatgtgaaaagcacc
accatagctgtgcgaggcagtcagccatgttgggaacaggacttcatgtttgagattaac
agactggatctgggcctgacagtggaggtatggaacaaaggactgatctgggacaccatg
gttggcacattgtggatccctctgagcagcattcgacagtccaacgaggaaggtccaggt
caatggctgactttagatgcccaggtcattatggctgagaatgaaatatgtggcaccaaa
gatcctacattccatcgagtgctattagatacacgatttgaactcccattagatatacca
gaggaggaagctcgatactgggccaagaaattggagcagctcaatgccatgagggaccaa
gattacacattccaggaggagcacgagagaccacttccaatgccatcaactcagtgctgt
aactggagtctatggggggaccaacaaaatgatgatccagacagtgctgtggatgatcga
gacagtgattaccgcagtgaaaccagcaacagcatcccccctcctttctacaccacatcc
caacccaacgcatccatgcaccaataccccatccgacaaatgcaacatggatcccgctac
aacgaaatgcacgactacgactatgataaccagagggcaattagccccaccggcagtagt
cgctatgcctcatctggtgaactgagccgtggcagctcccaactcagtgaggagtttggc
ccggaggatggcgagagctttcggggttctggagagttctacgatgagaatgattcctac
cattcctgccattcctctgttagctatggcaaagaatcacccggctgggacccagatgag
ccacagggtgtctacagtgatgatggggagtacaacaaagatggaggtgaagaaggggca
ctctatgatgaagagggtgagatctatgaacaggatgaaggggagtatccctatgaagag
gaagaggaaggaatggtgtatgaagaggacgaagacctttacccattggatggcactctt
agcgaagagcaggagcctccctacactcctaccccgaccagcactgccccaacattggct
cctgatgccctcacaagccgtccaccactagagaaacaggcttccatgcaccagcaacag
ccctcacaatcccaaataccattccagcccatggagcccaagcgagagtcaccacctcca
cagcagacacatgatgtttttgccaaggtacctcgtaccacaaccccaccacagatctca
gacacggagcctgagaaagtcccaacgccaccaggcaatgggccagcctatgcagaggat
ctcttgtccacatctaccactgagatcccacccaaagcagaacaggaaaagaaagaggct
cttcctgagagggccaaagccaactggctacgacttttcaacagggttcgccttcagctg
caggaggctcgaggcgagactccgggacttgcgtcactctttttgcaagcagggcctgga
ggtgctctctacagcatagacagcatgcctgaccttcgcaagagaaaggccatccctctt
gtccgagacctgtctctagtacagaactctcgaaaagccggcataacttccgctatggcc
tccagcacacttaacaatgaagaattgaagagtcacgtctataagaaaaccctgcaagct
ttgatttaccccatctcctgcactacgccgcacaactttgaggtgtggacggccacaaca
cccacctactgctatgagtgtgaggggcttctttggggcatcgctcgacagggcatgcgc
tgcacagaatgtggggtcaagtgccacgagaagtgtcaagatttactcaatgccgattgc
ctgcagagggcggcagaaaagagctctaaacatggagctgaagatcgcacacagaacatt
attatggtgctaaaagaccgcatgaagatccgtgaacggaacaagcctgagatatttgag
ttgattcaggatgtgtttgcagtcattaaggccacacatgtggcacagatgaagcagatt
aagcaaagtgtcctggatggaacttctaagtggtcggccaagatcagcatcaccgtttta
tgtgctcaaggtctgcaggcaaaggataagaccggttccagtgacccttatgttacagtt
caagtaggcaaaaccaaaaaacgaacaaagaccatctacggcaacctcaaccctgtatgg
gatgagagttttaattttgagtgtcacaactcttctgatcggatcaaagtccgtgtttgg
gatgaggatgatgatattaagtctagagtaaagcagaagttcaaacgagagtctgatgac
ttcctcggtcagaccatcatcgaggtgcgaactttgagcggagaaatggacgtctggtac
aatctagataagcgtactgacaagtctgccgtgtcaggagccattcgtatgcacatcagt
gtggaaatcaaaggagaagaaaccgtagctccgtaccacgtccagtacacttgcttacac
gagaaccttttccactacttaacagacattcaaaacaatggtgtggtgaagataccagat
gccaagggcgatgacgcatggaaagtttactttgaagagacgccccaagaaatcgtggat
gagtttgccatgcgttacggagtggagtctatttatcaagccatgacacactttgcctgc
ttgtcttcgaagtacatgtgtcctggagtgcctgcggtcatgagcaccttactagccaac
atcaatgcttactacgctcacacaacccaagccactaacaacgtatccgcctctgaccgc
ttcgctgcctccaactttgggaaagaacgatttgtgaaacttctagaccagctccacaac
tctctgaggattgacctctcaatgtacaggaataattttccggctagcagtcctgaaagg
ctacaggatctgaagtctacggtggacctactgaccagtatcacattcttcaggatgaag
gtccaggagcttcagagtcctcctcgtgcaagtcaggtggtgaaagactgtgtgaaggcc
tgcctcaactccacctacgaatatattttcaacaactgccacgagctctacagccgagaa
taccaaacagacccaaacaaaaaaggagaggttcctccagaagagcaaggcccgagcatc
aagaacctggacttctggtccaagctgatcactcttattgtctccattattgaagaagac
aagaactcctacacaccctgccttaaccagtttccgcaagagctcaatgttgggaagatc
agcgcagaggttatgtggaacctgtttgcccaagatatgaagtatgcgatggaagagcac
gaaaagaaccgcctgtgcaagagcgccgattacatgaaccttcacttcaaagtaaagtgg
ctctacaatgagtactgcaaagacctgcctttcttcaagagccgagtgcctgaatatcca
acgtggtttgagccgtttgtcattcagtggttggatgagaatgaggaggtgtccagagac
tttttgcatggagccctggagcgtgacaagaaagatgggtaccagcaaacctcggagcac
gctctcttctcctgttcggtagtggatgtcttctcacagctcaaccagagctttgagatc
attaagaagctggagtgtccagacccacagatcgtcggacattacatgaagagatttgcc
aagaccatcagcaacgttctgctctcctatgcggatattatctccagagacttcccgaac
cactgcaccaaggagaaagtggtaataccctgcatcctcatcaacaatattcagcagctc
agggtacagcttgagaagatgtttgaggccatgggaggtaaagatttgaacgttgaagct
agcgacatcttgaaagaacttcagttgaagctcaacaatgttttggacgaccttgcaagg
atatttgccaccagtttccagccaaacattgaagaaaatgtcaagcaaatgggagatata
cttagccaggtgaagggaacgggaaatgtgccagcaagtgcttgcagcagcgtagcacag
gatgctgacaacgtcctccaacccatcatggactttcttgacagcaacctcacactattt
gccaagatctgtgagaagacagtcttgaagcgagtgctgaaggagctttggaagttggtc
atgaacacaatggagaagacgattgttctgccaccgctaactgaccaaacgggcagggtg
aagcttgcttgtcacagtgatggcactcaactcatattcaacgcagccaaggaactcggt
cagctttccaagcttaaggagcacatggttcgtgaggaggccaaggcactgtcgcctaaa
cagtgtgcagtgattgagttagcgctggatactataaagcaatatttccatgctggaggt
gtggggctgaagaagacgttcttggagaagagtccagatctccagtctctacattacgct
ctgtctctctacactcaggctaccgacaaactcatcaagacctttgttcagtctcagaat
acacagggtactggtgttgatgatgcagttggagaagtatctatccatgtggagatcttc
actcatcctaatactggagagcacaaagttacagtaaaggtggtggctgcaaatgaccta
cggtggcagacttctggaattttccggccctttgtggaagtctacatcattggccctcat
ctcagcgataagaagaggaagtacgccaccaagtccaagaacaacagctgggctccaaaa
tacaatgagaccttcacattcacgctgagtaacgaagtgggtccggaatgctacgagctt
caggtgtgtgtgaaagactactgcttcgcacgagaggaccgcaccgttggcatggcagta
ctgcagctgaaggatgtagcaccacgaggtagcgtagcatgctggctaccgctaggtaaa
cgtattcacatggacgaaaccggcctgacagttctacgaatcctgtcccagcgcaacaac
gatgatgttgcgaaagaatttgtcaagctcaaatctgaccagcgatctgctgaggagggg
cggagctaa

DBGET integrated database retrieval system