KEGG   Danio rerio (zebrafish): 568683Help
Entry
568683            CDS       T01004                                 

Gene name
usp9
Definition
ubiquitin specific peptidase 9 (EC:3.4.19.12)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     568683 (usp9)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   568683 (usp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 2551 aa AA seqDB search
MTATTRGSPVGGNDGQGQAPDGQSQPPLPQNQTSSPNSSNENSPVSPPDDQGQGDSPTPL
EEEEPAFPHTELAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLCKKGIDVKCEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNAHRLVELCVTKLSQDWFPLLELLAMATNP
HCKFHIYNGTRPSETVPAGVQLAEDELFARPPDPRSPKGWLVDLINKFGTLNGFQTLHDR
FMSGQALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKESWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKMQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMENMRQFSKEHADFDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVFLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GSDDIASRAIDLLKEIYTNLGPKLQANQVEIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYITECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVD
DLDIWSHTNDTIGSVRRCILNRIKANSTHTKIELFIGGEIIDPADDRKLIGQLNLKDKTL
ITAKLTQVSANMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHVRYISF
LWQVADLGCNLNMPLLRDGARVLMKLMPPDNATVENLRAICLDHAKLGENSLSPTLDSRF
FGPSPSQVLYLIEVVYALLMPASGTLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAVGFGHVKSVAEACQPVVEGTIPVSPINQTTHDQALVLQN
ALQNIPNPSAECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGCGSVQHVFSS
NEEISKIYEKTNAGNEPDAEDEQVCCEALEVMTLCFALMPTALDALSKEKAWQTFIIDLL
LHCQSKSVRQMAQEQFFLMATRCCMGHRPLLFFITLLFTVLGSTAKERAKHAADYFTLLR
HLLNYAFNSNINLPNAEVLLNNEIDWLKRIRDEVKRTGEPGVEETILEGHIGVTKELLAF
QTPEKKFYIGCEKGGASLIKELMDDFLFPASNVYLQYMKSGEFPTEQAIPVCSTPATINA
GFELLVALAIGCVRNLKQIVDTLTDMYYLGCEPLTEWEYLPPVGPRPTKGFVGLKNAGAT
CYMNSVIQQLYMIPPIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDEVFGYQHQFD
DKPSLSKSEDRKEYNIGVLRQLQVIFGHLASSRLQYYVPRGFWKQFRLWGEPVNLREQHD
ALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIR
NHQNLLDSMEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWE
RECAIKFNDYFEFPRELDMEPYTVAGVAKLEGSDVHPENQVIQQNEPSEPEPPCSSRYRL
VGVLVHSGQASGGHYYSYIIQRNGSGGEGERNRWYKFDDGDVTECKMDDDEEMKNQCFGG
EYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTLDKDSELVKYITELTVSSKPHQVKM
PSAIERSVRKQNVQFMHNRMQYSLEYFQFIRKLLTCNSVYLNSPPGQDHLLPEAEEMAMI
SIQLAARFLFSTGFHTKKIVRGPASDWYDALCILLRHSKNVRYWFAHNVLFAYPNRFSEY
LLECPSAEVRGAFSKLIVFIAHFSLQDGPCPTPIASPGPSSQGCDNLSLSEHLFRAVLNL
LRREVSEHGRHLQQYFNLFVMYANLGLAEKTQLLKLGVPATFMLVALDEGPGPPIKYQYA
ELGKLYTVVSQLVRCCDVTSRMQSSINGNPPLANPYGDPNTTTPIMPLQQLVVDILFVRT
SYVKKIIEDCSNSEDTIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLLQI
LFIEDSWQTHRIHNVLKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCSVAYQ
ILQSNGDLKRKWTWAVEWLGDELERRPYTGNTQYTYNNWSPPVQSNETSNGYFLERSHSA
RMTLAKACELCPEEEPDEQEALDEQDPSPPEDTALYPHSPGSKFQQNNLPHTQPYTGPAA
QHVNNPQRPGPRAQENWEPPEETPQPSQTKD
NT seq 7656 nt NT seq  +upstreamnt  +downstreamnt
atgacggccacgacccgtggctccccggtgggagggaatgacggtcagggccaggctccg
gatggccagtcccagccacccctgccccagaaccagacatcctctcctaactcatccaac
gagaactcccctgtgagcccgccagatgaccagggtcaaggggactctcccactcctctg
gaggaggaggagcctgctttcccccacactgaactggccaagctggatgacatgatcaac
agacctcgctgggtcgttccagttttgccaaagggtgaactagaagttcttcttgaagct
gctatagatctttgtaaaaaaggaattgatgtcaagtgtgaagcatgccagaggtttttc
agagatggcttgacaatatcctttacaaaaatactgacagatgaggctgttagtggatgg
aaatttgaaatccatcggtgcatcattaataacgcccaccgactggtggagctgtgtgtg
accaagctctctcaggactggtttcctctgctagaactcttggccatggccaccaacccc
cactgtaagttccacatctacaatggtactcggccctctgagactgtgccagctggggtt
cagctagctgaagatgagctgtttgcccgtccacctgaccctcgctctcccaagggttgg
ttggtggatttaataaacaaatttggcacattaaacgggtttcaaactctgcatgatcga
ttcatgagcggccaggctctaaatgttcagatcattgctgcactcattaagccttttgga
cagtgctatgagtttctcactttgcacacggtgaagaagtacttccttcccatcatagaa
atggttccccagtttctagaaaacctcacagatgaggaattgaaaaaggaagcaaagaat
gaagccaaaaacgatgccctgtcgatgataatcaaatctttgaagaacctggcatctcga
gtaccaggacaagaggaaacagtgaagaatttagagatatttaggttaaaaatgattctt
aggttattgcagatttcatcttttaatggcaaaatgaatgcactaaatgaagtaaacaag
gtgatttcgagtgtttcctactacacacatcgtcacggcaatcctgaagaggaagagtgg
ttgacagcagaacgcatggctgaatggattcagcagaacaacattttgtctattgtgctg
cgagacagccttcatcagccacagtatgtggagaaactggagaagatcctgcgatttgtc
atcaaagaaaaagctctaacgctacaggacctggacaacatctgggctgctcaggctggg
aaacatgaggctattgtcaagaatgttcatgatcttcttgcaaagctggcgtgggatttc
tcaccggaacagctggaccatctcttcgactgcttcaaggaaagttggactaatgcgagt
aaaaagcagagggagaagttactggaattgattcgtcgactggcggaagatgacaaggat
ggtgtgatggctcacaaagtgctcaacctcctatggaatttggcccatagtgatgatgtt
cctgtggatatcatggaccaggctcttagtgctcatatcaagattttggactatagctgc
tcccaggacagggacacacagaagatgcagtggatagacagattcatagaagaattgaga
actaatgacaaatgggtgattcctgcactgaagcaaataagggagatctgtagccttttt
ggagaagccccacagaatttaagtcaaacccagcggagcccacatgtcttctatcgacat
gatctaatcaaccaactacagcataaccatgcactggttacacttgtagcagagaacctg
tctgcgtacatggagaatatgaggcagttctcaaaagagcatgccgactttgatcctcag
acagttcggccaggaagtcgatatagtcatgttcaagaggttcaggagcggcttaatttc
ttaagattcttactgaaagatgggcagctctggctatgcgctccccaggctaagcagatc
tggaagtgcctggcggagaatgctgtgttcttgtgtgatcgggaggcctgctttaaatgg
tactccaaactgatgggggacgaacctgaccttgaccctgacatcaacaaggacttcttt
gagaacaatgtgctgcaactcgacccctcactgctgacggagaacgggatgaaatgcttt
gagcgatttttcaaggctgtcaactgcagggagggcaaactggttgcaaaacggcgggcg
tatatgatggatgacttggagcttatagggctggattacctgtggagggttgtgattcaa
ggaagcgatgatattgctagccgagcaattgacttgcttaaagagatttatacaaacctt
ggaccaaaattacaagccaatcaggttgagattcatgaggattttattcagtcttgcttt
gaccggctcaaagcctcctatgacactttgtgtgtgctggacggagataaagacagcatt
aactgcgccaggcaggaggccattcgcatggtgagagtactgactgtgctcagggagtat
ataacagagtgtgacagcgactaccatgaggaaaggaccatcctgcccatgtccagggct
tttagaggaaagcatatcacactagttgtgcgttttccaaaccaaggccgacaggttgat
gatctggacatttggtcacataccaatgacacaattggttctgtgcgacgctgcatccta
aaccgaataaaggcaaacagcacacacacaaagattgaactcttcatcggaggagagatc
attgacccagcagatgacaggaagctaattgggcagctaaacctcaaagacaaaacactc
atcacagccaagctcacccaggtcagcgccaacatgccttccagtccagacagctcctca
gactcctccactggttcccctgggaatcatggcaatcactacagtgatgggccaaaccct
gaagtagagagctgtcttcctggtgtgataatgtctctacacgtgcgctacatctccttc
ctctggcaagttgcggacctgggctgtaatctcaacatgcctctcctacgggatggcgct
cgtgtcctaatgaagctcatgcctccagataatgccacagtggaaaacctgcgagccatc
tgtctggatcatgccaaacttggtgaaaacagccttagccccacgttggactcgcgcttc
tttgggccgtcaccgtctcaagtgctttacctgatagaggtggtgtatgcattgctcatg
cctgccagcgggacattgggtgaggatgctagcgacttccaatacaacttcttgaagagt
ggtggcctgcccctggttttgagcatgctcaccagaaataacttcctgccaaatgctgac
atggagacccggcggggagcttatctcaacgcactaaaaatagccaaactgctgcttaca
gctgtaggctttggccatgtgaagtctgtggcggaggcctgccagcctgtggtggagggg
actatccctgtgtcgcctatcaaccagaccacacatgaccaggctctagtgctccagaat
gccttgcagaatatccccaacccctctgccgagtgcatgctgcgcaatgtggccatccgc
ctcgcccaacagatctccgatgaggcctccaaatacatcccagatatctgtgtaattcga
gcagttcagaagatagtctgggcttctggttgtggctctgttcagcatgtcttcagttcc
aatgaggagatcagcaagatctatgagaagaccaatgctggcaatgagccggatgcagaa
gatgagcaggtgtgctgtgaagctctggaggtcatgaccctgtgtttcgctcttatgccc
actgcactagatgcacttagcaaagaaaaggcttggcagaccttcattatagatctgctg
ctgcactgccagagcaagtctgttcgtcaaatggctcaagagcagtttttcctcatggcc
actcgatgttgcatgggtcataggcctctcctgttcttcatcaccctcctcttcacagtt
ttaggtagcactgcaaaagagcgagctaagcacgctgctgattacttcactcttctaagg
cacttactcaactatgcatttaacagcaacataaatcttccgaacgctgaagttctctta
aacaatgagattgactggctgaagcgcatccgggatgaagtgaaaaggactggagagcct
ggggttgaggaaaccattttggaaggtcacattggtgtcaccaaagagctactggctttc
cagaccccagaaaagaagttctacattggctgtgaaaaaggaggggctagtctcatcaag
gagttaatggatgacttcctgttcccagcatctaatgtgtacttgcagtatatgaagagt
ggagaattccccactgagcaggccatacctgtgtgtagcacccctgccaccattaatgcc
ggctttgagcttctggttgcacttgccatcggatgtgtgcgaaatctgaagcagattgtg
gacacgttaactgatatgtactatttaggttgtgaaccactcacagaatgggaatatttg
ccaccagttggtccacggcccaccaagggctttgtgggtctgaaaaatgcaggtgcaact
tgctacatgaactctgtgatccagcagctctacatgattcctcccatcagaaacggcatc
ttggccattgaaggcacaggcagtgatgtggatgacgatatgtctggagacgagaagcaa
gataatgagagtaatgtggatccccgtgatgaggtgtttggctatcagcaccaatttgat
gataaaccctctctcagtaagtcagaggacaggaaggaatacaacattggggttcttcgc
caattgcaggtcatctttggacacttggcttcctccaggttgcaatattatgtgcctaga
ggattctggaagcaatttcggctgtggggagagccagtcaatctgagggagcagcatgat
gccctggagttcttcaactcgctggttgacagtttagatgaagctttgaaagcattgggt
caccctgccatgctgagcaaagtgctgggcggctcttttgctgaccagaaaatatgtcag
ggctgtcctcacagatatgaatgtgaggaatcatttacgacattgaatgtagatatcaga
aaccatcaaaatctgctcgattctatggaacagtatgtgaaaggggacttgcttgaaggt
gcaaatgcctaccactgtgaaaaatgcaacaagaaggtggacacagtgaagcgtttactc
attaagaagcttcctccggtgctggccatccagttgaaacggtttgattatgactgggaa
cgagagtgtgccattaagttcaatgactactttgagtttccacgagagttggacatggaa
ccctatacagtagcaggagtagctaagctggaagggtcagacgtgcacccagaaaaccag
gtgatccagcagaatgagccatcagagccggagccgccctgcagctctcgctatcgtttg
gtgggagtgctggtccactcaggacaggctagtggaggtcattattactcttacatcatt
cagaggaatggcagcggtggcgagggagaaagaaaccgttggtataagtttgatgatggt
gacgtcaccgagtgcaagatggatgacgatgaggagatgaagaaccagtgctttggagga
gagtacatgggtgaggttttcgaccacatgatgaagcgcatgtcttacaggcgacagaag
cgctggtggaacgcttatatcctgttttatgagcggatggacacattggacaaggacagc
gagctggttaaatacatcactgagctcacggtgagcagcaaacctcatcaagtgaagatg
ccctctgctattgagcgcagcgtgcgcaaacaaaatgtgcagtttatgcacaaccgcatg
cagtacagcttggagtacttccaattcatcaggaaactgctgacctgtaacagtgtctac
ttgaactcaccgccaggtcaagaccaccttttgcctgaagcagaggagatggctatgatc
agtatacagctcgctgctagatttctcttcagtactggattccacaccaagaaaatagtc
cgtggcccagctagtgattggtatgatgctctgtgcatcttgttgagacacagtaagaat
gtgcgttactggtttgcacacaacgtcctctttgcatatccgaatcgtttctccgagtac
ctgcttgagtgccccagtgcagaggttcgaggggccttctccaaactcatcgtattcatt
gcacatttctccctgcaagatggaccctgccccacaccgattgcctcacctggaccttca
agtcagggctgtgataatttgagtttaagtgagcacttgttccgtgctgtgcttaatctt
ctacgaagggaagtgtctgaacatggccgtcacctgcagcagtactttaaccttttcgtc
atgtatgccaaccttggcttggcagagaagacacagctgttgaagcttggggtaccagcc
actttcatgcttgtggcactggatgagggtccgggccctccaattaagtaccagtatgct
gagctgggaaagctctatactgttgtctcacagctagttcgctgctgtgatgtgacatca
cgcatgcagtcctcaattaatggtaaccctccgctggctaacccatatggagaccccaac
accaccactcccatcatgcccctgcagcagttggtggtggacatcctttttgtgcgcacc
agttatgtgaagaagattatcgaggactgcagtaactcggaggacactatcaaactgctg
agattctgctgttgggagaaccctcagttttcctccactgtgcttagtgaactactgtgg
caggtggcgtattcatacacgtatgagttaaggccttacctggacttgctccttcagatc
ttgtttattgaggactcatggcagactcacagaatccacaatgttctgaagggaattccc
gatgaccgcgatgggctttttgacaccattcagcgctccaaaaaccactaccaaaagaga
gcttatcagtgcatcaaatgcatggtggctctcttcagcaactgctcagtggcctatcag
attctccagagtaatggagatctaaagaggaagtggacctgggcagtggagtggctcggt
gatgagttggaacggagaccttacactggcaacactcagtacacctacaacaactggtcc
cctcctgtccagagcaatgaaacctccaatggatacttcctggagcgctcccacagtgcc
cggatgaccttagccaaggcctgtgagttgtgcccagaagaggagcctgatgagcaggag
gccctggatgagcaggacccttctccaccagaggacactgctctctaccctcactctcca
ggcagcaagtttcaacagaataacctcccgcatacgcagccctacactggccccgccgca
cagcacgtcaacaaccctcagcgtcccggcccacgagcacaagagaactgggagcccccc
gaggagacgcctcagcccagccagactaaagactaa

DBGET integrated database retrieval system