KEGG   Danio rerio (zebrafish): 568759Help
Entry
568759            CDS       T01004                                 

Definition
si:ch211-11p18.4
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    568759
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    568759
   04261 Adrenergic signaling in cardiomyocytes
    568759
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   568759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
22
AA seq 1052 aa AA seqDB search
MHWARRIEQEIDRVLQHISGAQQLKGIYLEKKKHFSLVRNNPRDIVEKVATDIERLLAKK
RKALERLASEAERLQKEHRWQDGIKDGEDIDSQMSLKLDFVYDPSFKNQVNYSHTAVQIP
TDIYKGAPVILNELNWTQALERVFIENSRDDPSLLWQAFGSATGVTRYYPAAPWRAPDKI
DLYDVRRRPWYIQGASSPKDMVILVDVSGSVSGLTLKLIKASVTEMLDTLSDDDYVNVAR
FNEKAEAVVPCFDHLVQANVRNKKIFKEAVQQMQAKGTTDYKSGFHFAFNQLLNKTNVPR
ANCNKIIMLFTDGGEDRAQDIFEQYNWPNKTVRVFTFSVGQHNYDVTPLQWIACSNKGYY
FEIRSICAIRINTQEYLDVLGRPMVLAGRIAKQVQWTNVYQDALGLGLVVTGTMPVFNLT
VNGDSQNQLILGVMGVDVHLDELKRLTPQYKLGANGYIFAIDPNGYVLMHPNLQPREEDL
PEQVTLDFLDAEVEDSSKQEIRRQMIDGRSGDMTIKTLIKSMDEASRYIDDVTRMYTWTP
INDTDYSLGLVLPPYSEHYIQADLSDVMLQLQYLQSLLPNSFESAGHVFLAPRDYCRRLH
ISENNTQFLVDFLSLMVEISPESEDCDQGLIHNLILDSGILWQLATRVWQNKDLGTYGFL
ALFASTNGGVTRVYPNMAAESWDEDPEPLNSNFYRRSLDNKGYIFRAPTRTSMDDLLISE
NGTVGILVTTAVEVAFGSKTMKPAVVGVKLDLEAWVDKFKILASNVSDSRQAAHKCGPSR
SCEMDCEVNSDDLLCYLIDDGGFLVMSNQRDHWKKVGLFFGEVDPYLMFALYNNSIYSRH
QTFQYQSACEPTASSHTGAAHRGFYVPSIADFLSLAWWTSAAAWSILQQFLYGVMYSSWF
TTADVWAESADSKGSSSCVTVYSQFYFTNTTNSFNVLQDCGNCSSILTTNSLSVRLFHAK
RIENTNLLFVVAETLPCSSCEIEKLLPVRTKSQEENPCDVLNSARYRKGPDKCFDYNSEE
NTSQCGSAHSLHCPLPALLLVQLFLIYLILRS
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgcactgggctcgacgcattgaacaggagatcgacagagttttgcagcatattagtggc
gctcagcaactgaaggggatctacttggaaaagaaaaagcacttcagtctggtcagaaac
aaccctcgagacattgtagagaaagtagcgactgacatcgagagactgcttgccaagaaa
cgcaaagcgctggagagactggcgagtgaagcggagcgtcttcagaaagagcatcgctgg
caggatggaatcaaggacggtgaggacattgactctcagatgtccttgaaactggatttt
gtgtacgacccaagcttcaaaaaccaagtgaattactcgcacactgccgtccagatcccc
acagacatctacaaaggcgctccagtgattctgaatgagctgaactggacgcaggcgcta
gagcgagtcttcattgagaacagcagagatgatccctcattgctttggcaagcatttggt
agtgccaccggtgtcaccagatattacccagctgctccctggagagcgccagataagatc
gacctttatgatgtacgacgaagaccctggtacattcaaggagcgtcgtcacccaaagac
atggtcattcttgtagacgtgagcggcagcgtcagcgggctcacattaaaactgatcaaa
gcttcggtcacagaaatgctcgacacactctccgatgatgattatgtcaacgtggccagg
tttaatgagaaggcagaggcagtggtgccctgtttcgatcacctggttcaggccaatgtg
cgcaataagaagatcttcaaagaggctgtgcagcagatgcaggccaaagggaccaccgat
tacaaatccggcttccatttcgccttcaaccagctcctgaacaagacaaacgttcctcga
gccaactgtaataaaatcatcatgttgttcactgacggcggagaggaccgagcgcaggac
atcttcgagcagtacaactggcctaataagacggtccgcgtgttcacgttctcggtgggg
cagcacaattacgatgtcactccgctgcagtggattgcatgctctaataagggatactat
tttgagatccgctccatctgtgctataaggattaacacccaggaatatctggatgtattg
ggtcgcccgatggttctggcaggcagaatcgccaaacaagtacagtggacaaacgtctat
caggacgccctgggtctgggtctggtggtgacagggacaatgccggtgttcaaccttact
gtgaacggggactctcagaatcagctgattttaggtgtgatgggggtcgacgttcatctg
gacgagctgaagagactcacaccacagtacaagctcggagccaatggatacatcttcgcc
attgacccgaacggatacgtgctgatgcatccaaacctgcagcctcgagaagaggattta
ccggagcaggtgactctggactttctggatgcagaagtggaagacagcagcaaacaggag
attcgccggcagatgattgacggccgatcgggagatatgaccattaaaactctaattaaa
tcaatggacgaggcaagtcgctacattgacgacgtcacccggatgtacacctggacgccc
atcaacgacacagactacagtctaggtttggtactgcctccgtacagtgaacattacatc
caagctgatctgagtgatgtcatgctccagctgcagtatttacagtctctgctgcccaac
tctttcgagtctgccggtcatgtgtttctcgctcccagagattattgcaggcgcctgcac
atctctgaaaacaacacacagttcctggtggacttcctgtctctgatggtggagatctca
ccggagtctgaagactgtgatcagggtctcattcataacctgatcttggactccgggatc
ctctggcagctcgccacacgcgtttggcagaataaagacctgggcacgtatggctttctg
gctctgtttgcgtccaccaatggaggcgtcacacgtgtttaccccaacatggcggctgaa
tcatgggatgaagatcctgaaccactaaactcaaacttctaccggcgcagtctggataac
aaaggctacatcttcagagcgccgacacgaacctcgatggatgatctgctgatctcagag
aatggcactgtggggattctggttaccaccgccgtagaggttgcatttgggagcaaaacc
atgaagcctgcagtggtcggcgttaagctggatttggaggcttgggtcgacaagttcaag
atcttggccagcaacgtgtccgacagcagacaggccgcacataagtgcggcccgtccaga
tcctgtgagatggactgtgaagtgaacagcgatgatttgctgtgctatctgatcgatgat
ggcggtttcctggtgatgtccaatcagagagatcactggaagaaggttgggctgtttttc
ggtgaggtcgacccgtacctgatgttcgccctctacaacaactcaatctactcccgtcat
cagaccttccagtatcagtcggcctgcgaacccacagccagcagccacacaggagccgca
cacagaggattctacgtgccctccatagcggactttctcagcctagcctggtggacgtct
gcagccgcgtggtctattttgcagcagttcttgtatggagtcatgtacagcagctggttc
accacagcagacgtctgggctgagagtgcagacagtaaagggagcagcagctgtgtgacg
gtttacagccagttctacttcaccaacaccaccaactccttcaacgtcctgcaggactgc
ggcaactgctccagcattctaaccacaaactctctttctgtcaggttgttccatgccaag
cgtatagaaaacacaaaccttttgtttgtggtggctgagacactgccctgcagctcctgc
gagatcgagaaactcctgcctgtcagaaccaagtctcaagaagaaaacccatgtgatgtc
ttaaactcggcccgctataggaaaggacctgacaaatgcttcgactacaactcagaggag
aacacatcacagtgtggcagcgctcactctttacactgtccgctgccagctctgctcttg
gttcagttatttttgatttacctcattctacgatcgtaa

DBGET integrated database retrieval system