KEGG   Danio rerio (zebrafish): 568877Help
Entry
568877            CDS       T01004                                 

Gene name
hdac4, wu:fa96d08, wu:fc56f08, zgc:152701
Definition
histone deacetylase 4 (EC:3.5.1.98)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     568877 (hdac4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 1023 aa AA seqDB search
MVDVSVALPLQVPPSAIPMDLRVDHQFALAPTDPAQREHQLQQELLALKQKQQIQRQLLI
EEFQRQHEQLSRQHEAQLQEHVKHQQDLLALKHQQELLEHQRKLGRHRQEQEMEKQQREQ
KLQLLKNKERGQESAVASTEVKMRLQEFVLNKKKALAQRSLNHCLPSDPRYWYGKTQHSS
LDQSSPPQTGISTYNHPVLGMYDPKDDFPLRKTASEPNLKLRSRLKQKVSERRSSPLLRR
KDGPITTAKKRSLDMAESACSSAPGSGPSSPNNSSNNITNENGIAGSISNSAVEPSLAHR
LTGREGPVSQLSLYTSPSLPNITLGLPATGPSSVASGQQDGDRMAVPGLQPGIPITTPFM
PGAHLPSYLAASSLERESGSAHNTLLQHMVLLEQSAAQNSLVAGLSGVPLQSHSIHKLRQ
HRPLGRTQSAPLPQNSQALQQLVVQQQHQQFLEKHKQQFQQQQLHISKMMVKPSEPNRQH
ESHPEETEEELREHQGLGDPADPLPHGVTIKQEPPDEQDEDFQQRERQAEEELLFRQQAL
LLEQQRIHQLRNYQASMEAAGLSVSFPVHRPLSRAQSSPASATFPIVVQEPPAKPRFTTG
LVYDTLMQKHQCMCGNSNIHPEHAGRIQSIWSRLQETGLRGQCECIRGRKATLEELQTVH
SEAHVLLYGTNPLRQKLDSSVTPMFVRLPCGGIGVDSDTIWNEVHSSSAARLAVGSVVDL
VFKVASGELRNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDV
HHGNGTQQAFYSDPNVLYLSLHRYDDGNFFPGSGAPDEVGIGPGVGFNVNMAFTGGLEPP
MGDADYLAAFRSVVMPIANEFSPDVVLVSSGFDAVEGHPPPLGGYKLTAKCFGYLTKQLM
GLAGGRLVLALEGGHDLTAICDASEACVSALLGNELDPIPEDILQQRPNANAIQSMEKVL
EVQSKYWRSLQRSVSTLGYSLREAQRCENEEAETVTAMASLSVANKHMGKRPEEEPMEEE
PPL
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtgagtgtggcgctgccactgcaagtgccaccttctgccatccctatggac
ctgcgtgtggatcaccagttcgccctggcgccgacagacccggcccagcgtgagcatcag
ctgcagcaggagcttctggccctcaagcagaaacagcagatccagaggcagctcctgatc
gaagagtttcagcggcagcacgagcagctctcccgacagcatgaagcccagctgcaggag
catgtcaagcatcagcaagatctgttggctttgaagcatcagcaggagctcctggaacac
cagcgcaagttggggcgtcatcgacaggagcaggagatggagaaacagcagcgagaacag
aagctacagttactcaaaaacaaagagcgcggacaagagagcgccgtggcgagcactgag
gtcaagatgaggttgcaggagttcgtcctcaataagaagaaagcgctggcccagaggagt
ctcaaccactgcctgcccagcgacccacgctactggtacgggaaaacccagcacagctct
ctggaccagagctcaccacctcagacagggatttccacttacaaccacccggtgctggga
atgtacgaccccaaagatgacttcccgctccgcaagacggcatctgagcccaatctaaag
ctgcggtccaggctgaagcagaaggtcagcgagcgcaggagcagccctctgctaaggagg
aaggacggacccatcaccactgcaaagaaacgctctctggacatggcagagtcggcatgc
agcagtgctcctggttctggcccgagttcacccaacaacagctcaaacaacattaccaat
gagaacggcatcgctggatcaatctccaacagcgcagtggagccatcgttggcacacaga
ctcacgggcagagagggtcctgttagccagctgtctctgtacacatcgccctcccttcca
aacatcaccctgggtctgccagccaccggcccctccagcgtggcatcaggccagcaggat
ggtgacaggatggcagtgccaggcttacagccaggaatccccataaccactccgttcatg
ccaggagcccacctgccgtcatacctggccgcctccagcttggagcgggaaagcggctcg
gctcacaacactctcctccagcatatggtgcttctggagcagtcggccgctcagaactcc
ctggtcgcaggtctgtcaggtgttcccctgcagtctcattccatccacaagctccggcag
catcggcctctcggacgcacccagtcggcgccgctgccccagaactcccaggctctgcag
cagctggtggttcagcagcagcaccagcagttcctggagaaacacaagcagcagttccag
cagcagcagctccacatcagcaagatgatggtgaaaccgagcgagccgaaccgacagcac
gagagccacccggaggagacagaagaggagctgagggagcaccaggggctgggagacccc
gcagaccctcttcctcacggggtcaccattaaacaagagcctccagatgagcaggacgaa
gactttcagcagagagagagacaagcggaggaggagctgctcttcagacagcaagctctc
ctattggagcagcagagaattcatcagctgaggaactatcaggcgtccatggaggcggcc
ggactgtccgtgtcttttccagtccatcggcctctttccagagcacaatcatccccggcc
tctgccacatttcccatcgtggtgcaggaacctccggccaaaccacgctttactaccggt
ctggtgtacgacacactgatgcagaaacaccagtgcatgtgtggaaacagtaacatccac
ccggagcacgccggacgcatccagagcatctggtcacgactgcaggaaactggcctgcgt
ggacagtgtgagtgtattcgaggcaggaaagccactctggaagagctccagacagtccac
tctgaggcccatgtgctgctttatggaaccaaccctctcagacagaaactggacagttct
gtgacacccatgttcgtgagactgccttgcggaggaatcggggttgacagcgacacaatc
tggaatgaagttcactcatccagtgctgctcgtctggctgtgggttcagtggtggatctg
gtgtttaaagtggcatcaggagagctgaggaacggttttgctgttgtgcggcctccagga
catcacgctgaagaaagcactcccatgggattttgctatttcaactcggtcgccatcgca
gccaaactcctgcagcagagactcaacgtcagcaagattctcatcgtggactgggatgtt
catcatggaaatgggacgcagcaggccttttacagtgaccccaatgtgctgtatctgtct
ctccatcgctatgatgatggaaacttcttccctggcagcggagctcctgatgaggtgggc
atcggtccaggtgtgggctttaatgtcaacatggccttcactggaggtctggagccacca
atgggggatgcagattatctggcagcattcaggtcggtggtgatgccgatagcgaatgag
ttttctccagacgtggtgctggtttcctcaggcttcgacgctgtggaggggcatccgcca
cctctgggaggatacaagctcacggccaaatgttttggctatctgaccaagcagctgatg
ggactggccggtggtcggctggtgctggcgctggaaggaggtcacgacctcaccgccatt
tgcgatgcctctgaagcatgtgtttctgctttgcttggaaacgagttggaccctattccc
gaagacatcctacagcagagaccgaacgccaacgccattcaatccatggagaaagttttg
gaagtccagagtaaatactggcgttcactgcagcggtcagtctcgactctgggttactct
ctccgtgaggctcagagatgtgaaaatgaagaggcagagacggtcaccgccatggcctcg
ctgtctgtggccaacaagcacatggggaagaggcctgaggaggagcccatggaagaggag
cctccattgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system