KEGG   Danio rerio (zebrafish): 568885Help
Entry
568885            CDS       T01004                                 

Gene name
rasgrf1
Definition
si:ch211-234p18.3
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Focal adhesion
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18
AA seq 1256 aa AA seqDB search
MQKGIRLNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSS
RPSGLYLLEGCVCDRSPSPKPSLSAKECLEKQYYFTVSFNHENQKALELRTEDVKDCDEW
VAAISHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAA
MLKDNEKIQSSPTTAPSDDDSEIKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVVSLIDCTLIEEPEGTDDESKSEK
SGQDMEHLDFKIVVEPKDSQSFTFILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEE
NSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFL
NTFLHSYRVFTSADVVLDKLITIYKRPISAIPARSLELFFASSQNNKLLYGEPPKSPRAS
RKFSSPPPLAITKTSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSTMSPFSK
TTLDINKLYVSSPITSKIPDEGEGKTDKADEISLCKQDNSVREESDNDQIQSDEAEAEVS
PTKSPTTPKNVKCKNSSEFSLFSYNNGMVMSSCRELDNNRSALSAASAFAIATAGANEGT
PTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNTELKM
KVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQICLEEVLQMAEGGKSESFENH
SALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTKHFNDISDLIATEI
LRCEDVNVRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKT
VIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSK
MRMISHIIREIRQFQQTAYKIDYQPKAALYLLDRSAVMEEEGLYEASLRIEPKVPN
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagggaattcggctgaatgatggtcatgtcacctacctgggtcttttggcgaag
aaggatggcacgaggcgaggctgcttaagcaaaaagagctccgacaacacaaaatggcac
accaagtggtttgctctgttgcaaaatatgcttttttattttgagagcgagtccagctcg
cgaccctcgggattatacctgttggagggatgtgtgtgtgacaggtcgccctcacccaaa
ccttcactgtcagccaaggagtgcttagaaaaacagtattatttcacagtcagcttcaac
catgagaatcagaaggccctggagcttcgcacagaagatgttaaggactgcgatgaatgg
gtggcagcaatatcacatgccagctacagaaacctggccaccgagcatgaaacgctcatg
cagaagtacctccatctactccaaatcgtggagaccgagaaaacagttgctaagcaactt
cgacaacagatagaagatggggagattgagattgaacgtctaaaatcagagattgcagca
atgctcaaagacaatgaaaagattcagtcaagtcccaccacagcacccagcgatgatgat
tcggagatcaagaaaatcaagaaagtgcaaagcttcctgagaggctggatgtgtcggcgg
aagtggaagaccatcattcaggactacatccgttctccacatgccgagagcatgaggaag
agaaaccaggtggtctttagcatgctggaggcggaggctgagtacgtccagcagctccac
atccttgtcaacaacttcttgagaccgctgcgcatggctgccagctccaaaaagccaccc
ataacccacgatgatgtcagcagcatattcctcaacagtgaaaccataatgtttctgcat
cagatattctaccaagggttgaaagctcgaatagcaagctggccaacattagtcttggct
gacttgtttgacatcctgttgcccatgctgaacatctaccaggagtttgtgcgtaatcac
cagtacagcttgcagatcttggcccactgcaagcagaaccgcgatttcgacaagctgctg
aaacagtatgaagccaagcctgactgtgaggaacgcacgctggagacgttccttacttat
cccatgtttcagattcctcgttacatactgaccctccatgagctgttagcacatacaccg
catgagcatgtggagagaaacagcttggattacgccaagtcgaagttggaggagctttcc
agaatcatgcatgatgaggtgagcgagacggagaacatccggaagaacctcgctatcgag
cgcatgatcgtggagggctgtgagattctcctagacaccagccagacctttgtcagacaa
ggatctctgattcaagtgcccatgagtgagaagggcaagatcacccgggggcgactgggg
tctctgtctctaaagaaagagggtgagaggcagtgtttcctcttctccaaacatctaatc
atctgcactagaggctctggagggaaactgcacctcaccaagaacggagtggtgtcgctc
attgactgcacactgatagaggaaccagagggcactgatgacgagtccaaatcagagaag
agcggtcaggacatggagcacctggattttaagattgtggtggagcccaaagacagccag
tcattcaccttcatcctggtggcctcctcgcggcaagagaagtcagcctggaccagtgac
atcagccagtgcatagataatattcgctgtaatgggctgatgatgaacgcctttgaggag
aactctaaagtcactgtgccacagatgatcaagtctgatgccagtctgtactgtgatgac
gtagacatccgcttcagtaagatgatgaactcgtgcaaggtgttgcagatccgctatgcc
agtgtggagcgtctgctggagaggctgaccgacctgcgcttcctctccattgactttctc
aacaccttcctgcactcctaccgcgtgttcaccagtgctgacgtcgttctggacaagctc
atcaccatttacaaaaggcccatcagcgccataccagcccgatccctggagctgtttttt
gcgagcagccagaacaacaagctcctctatggagagcctcccaagtcgccccgtgccagc
cgcaagttttcgtccccaccgccactggccatcactaagacttcatctcccaatcgccgc
cgcaaactgtccctcaacatccccatcatcaccggagggaaggctctggatctggcagcc
ctcagctgttcctccaatggctatgcaagcatgtactctaccatgtcccccttcagcaag
accactctggacatcaacaagctctatgtgtccagtcccatcaccagcaagatccccgac
gagggagagggcaagacggacaaggcagatgaaatttctctctgcaaacaagacaattca
gtgagggaggaaagcgataacgaccagatccagagtgatgaggcagaggctgaagtgtcg
cccaccaaatcacccaccactcccaaaaacgtcaaatgcaaaaactcctcagaattctct
ctgttctcttacaataatggcatggtgatgtcatcctgccgggagctggataacaaccgt
agcgccttgtctgccgcttctgccttcgccatcgccactgcaggtgccaacgagggcacg
ccaaccaaggagaagtaccgccgcatgtctttggcaagcacagggttccctacggatcag
aggaacggagataaggagtttgtgattcgccgagcagcaactaacagagtcctcaatgtc
ctcaggcactgggtgtccaaacactcacaggactttgaaaccaacactgagctcaagatg
aaggtaatcagcttcctggaggaggtgatgcacgatcctgaacttctgacccaagaaaga
aaggctgctgccaacattatacgaacactaacgcaagaggatcctggtgataatcagatc
tgtctggaggaggttctgcagatggctgaaggaggaaagtcagagtctttcgagaaccat
tcagctctggagattgcagagcagctcaccctacttgaccaccttgtattcaaagtcata
ccatatgaagagttttttggtcagggatggatgaagaatgacaaaaatgaaaagacacct
tacatcatgaaaacaacaaaacacttcaacgatatcagtgacctgatcgctacagagatc
ctgcgctgtgaggatgtgaatgtacgggtagcagtgatggagaagtgggtggcggtggct
gatatctgccgctgtctccacaactacaatgctgtgctggaaatcacctcgtccctcaat
cgcagctccatcttccgcctgaagaaaacctggctcaaagtctccaagcagaccaaaaca
gtcattgacaagctgcagaagttggtctcgtctgaaggaaggttcaagaacctcagagag
gccttaaaaaattgtgaccctccctgtgtgccatatttgggaatgtatctcactgacttg
gcctttattgaggaggggacgcccaactacacagaggacaacctggtcaatttttccaag
atgcgaatgatttcccatatcatccgagaaatcaggcagtttcagcaaacggcgtataag
attgattaccagccgaaggcagcactatatttactggacagaagcgcagtaatggaagaa
gaaggcctgtatgaagcctctctcagaattgagcctaaagtgcccaactga

DBGET integrated database retrieval system