KEGG   Danio rerio (zebrafish): 568932Help
Entry
568932            CDS       T01004                                 

Gene name
kat6b, id:ibd5103, si:dkey-24f15.3
Definition
(RefSeq) K(lysine) acetyltransferase 6B
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     568932 (kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
13
AA seq 2044 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKRQKQRPSEERICHAVSSTRGLDKGVVLHQLELAVKDGSI
LKVTSKGCASYKDPDNPGRITPFKLGGSGTVSVGSVIPAGDLRHVDWNKILRRAIEGLGV
PSGSSLRNIERFLRSQGDLVNVVANPRFQQRLRLAAKRAVNNGRLLKDGPLYRLNSGGLG
GKSCFRNVGVFGVDLPPVTLLPHERDQPRADPIPICSFCLGTKESNRDKRPEELLSCADC
GSSGHPSCLKFSADLTANVKALRWQCIECKTCSSCQIQGKNADEMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKEQEGKRLLHKTAAQIKRRYAKPGRPRKNLAHPTMSDSGGP
GSVELSEKARHGRGSISTFCTPPSSSTFIPTTDGRSLTDPLTSTPTLTTLPPINKKTKGL
IDGLSKFFTPSPLGRRLRGEASGSSNQHRPRKRGYRKHHASMMTPGVRLNAPSSVLLTPS
PSQGHSPISLNPTQSSSPSSAHSPHSSSSQSSGPSLSSLPGNSQLKGLFDGLSHIFTTQG
QSRQKGLPSYAPPKRVRRTQDMSTSPKMSLQLQGKKPVKGFCSKLASLASSASGWPPKRG
RPFKSALHFKRTPILRKHKLLGRFRFKASPQRENITPGKGRLADGRVKPDPNHAFNVERC
LRREPQEGRMTLVNDHVAEEDLKLFRHVKELTAKKNGGDQGQSPPLIEFGKYEIQTWYSS
PYPPEYLRLPKLYLCEFCLKYMKSQDILQRHSKKCGWFHPPANEIYRKDNLSVFEVDGNI
SKIFCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDEKGCHLVGYFSKEKLCQQKYNVS
CIMIMPQFQRQGFGRFLIDFSYLLSRLEGQAGSPEKPLSDLGRLSYLAYWKSVILEYLHN
HPDKSVSIRGMSRATGMCPHDIATTLQQLNMIDFQDGRFVIIQRHQLIEEHMDRLRVKPR
LHEVDPDCLSWTPALVCRSPPVDLKSALALQARDHRADYTASTRNLAMGMGYIGTRPPLT
KCKNFRRRYSDPLFGNSTGKDFEVSEESSSDDDDDNNDDDDDDEDGEDSAVQSQSGQGLK
RRRAPTMRRKRGRRRTRINSSVTTETILERTEVLDEPFENSDVESPLPEHSRRCCSEDEE
EEKSQRSAVCRPGRPRTNEEDNHSNQSKEEENVEVKKDNPRPAKRKKGWPKGVKRGPPKW
RLKERKMGFKLNLYTPPETPMVTVEQEQDDEQDASPASFSGPCQSFRESRPEDPELDTCV
SVPPSPEPPKSHKVNEDESTDKSDTVENSPSADDTNETTPGPIDDPEQSTQNAEELEDLK
PEGETEGRPVKGSGEGDEEEDEDEEPEPSHLDDHDADDEDDSHEQRMEDPVPLPERDLTE
DTEPSPSNNNNKQPEEQPSPGEPPSHCSEELASESALVNLGMQDGDTVDSDHTPDSETEE
EDNLEKPEEKQMGPLTPAIKEDHNICPELDMETAQAVQSLTQESEQERHFQDCAETQEAC
HSLQRYVHVEQSPQMTPVDDCQQSDHSSPLSSVHSHPSQSVRSVNSPAVSILESGYTQIS
PDQGTVSVHSLHNNMETSPIMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDST
LGNSICGTGAGAGASSQSSCSYGNLSSGGSHSQSSCAVSQQMAGPVVNNTGACSMLQQTS
MSSPQGCSVKSPQGCVPERQPSHSHGHGHGHGHGHGHSHSHHHSHHQHHPHHQHHQHPQH
QYQQPLSHCSMPASFPPPPMQLPDIPESNNPSTNLGLYDRMGQGEYGTGHYGHLHKLQQL
TNTIMDHSLPFSHSASHSIPSYANNNGSLSTQLGPHNPTLVSLSQPGGGPQSQSTVTPPP
NMTPPPMMLQRNMATPNMNLAPSQRLQTQMPPKNHHHHPVSIRSKSAPLPPHHQQQMYGR
GPQSVAMQAPGRTLAMPTRMNMGVNLMPAPAYNVNSMNVNVNMAMNTYRVTQPMMNGGYH
GNPTYMNQSPQYSMQMGMMGTQPYPQQPMQAPPHGNMMYSPAGHHSYVNTGMSKQPLNGP
YMRR
NT seq 6135 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactggccaatcccctgtacacagagtggattcttgaggctattcagaagatc
aaaaggcagaagcagcggccttcggaggagcggatttgccatgctgtctcatctacacgt
ggactagacaagggcgtcgtacttcatcagctggagctcgctgtgaaggatggatccatc
cttaaggttaccagcaaagggtgcgcttcgtacaaagacccggataacccaggaaggatt
acgcctttcaagttgggaggctctggcacggtctctgttggatctgtgatacctgcagga
gatctgcgtcatgtggattggaataaaatccttaggagggctattgaaggtctgggcgtc
ccgtctggctcctctctaaggaacattgagagattccttagaagccagggcgacctggtg
aatgttgtggcaaaccccaggtttcagcagaggctgaggctagctgctaagcgggcggtt
aacaacgggcgcctgctcaaagatgggccgctctacaggttgaacagtggtggacttgga
ggaaagtcttgcttcaggaacgtgggggtctttggtgtcgacctcccacctgtgacacta
ctcccccatgaaagagaccagccacgtgctgaccccatacccatatgcagcttctgtttg
ggcacaaaggagtcgaatcgagacaagaggccagaggagctgctgtcttgtgcagactgt
ggaagcagcggccatccatcatgcctgaagttctccgctgatttgactgcaaatgtcaag
gccctgcgatggcagtgcatcgaatgcaaaacatgcagttcctgtcagattcaggggaag
aatgctgacgagatgctcttctgcgactcctgcgacaggggtttccatatggagtgctgt
gacccaccgctctccagaatgccaaaaggaatgtggatctgccaagtatgcaggccaaag
gagcaggagggaaaacggttgctacacaagacagcggcccagatcaaaaggcgatatgca
aagccaggaaggccaagaaaaaatctagcacatccaacaatgtctgacagtggtggtcca
ggatccgttgagctgtctgaaaaagcacggcatggtaggggttccataagcactttctgt
accccaccctcatcaagcacctttatacccaccacagacggcaggagtctcactgacccc
ctcacatccacacccaccctcactacgttgcccccaatcaacaagaaaaccaaaggtctc
attgacgggctttccaaatttttcacgccatcgcccttgggtcgccggttgcgcggtgaa
gcgtcgggctcctcgaatcagcacaggccaaggaaacggggctatcggaaacaccatgcc
agcatgatgacaccaggtgtgaggttaaacgccccgtctagcgttctccttaccccgtcc
ccttcgcaaggacacagccccatctcgctgaaccccacccaatcatcctcgccctcctcc
gcccactcgccccacagctcctcctcccaatctagtggcccgtcccttagtagcctccca
ggcaacagccagctaaagggactctttgatggactgtctcacatctttaccactcaggga
cagtcccgacaaaagggactccccagctacgcaccacccaagcgagtgcgccgcacacag
gacatgtccacctcacccaaaatgtccctgcagcttcaaggaaagaagcctgtcaagggt
ttctgtagtaaattagcatctctggccagttcagcctcaggatggccgcccaagcggggc
cgcccgtttaagtcggcgctccatttcaaacgaactcccatcttgagaaagcacaagctg
ctaggcaggtttaggtttaaggcctccccgcagagggagaacatcacaccagggaagggc
agattggcagacggacgagttaaaccagacccaaaccatgcctttaacgtcgagagatgt
ttgagaagagagccgcaggaaggaaggatgactctagtcaatgaccacgtggctgaagag
gatctgaaattgttcagacacgtcaaggagctcacagctaagaaaaatggcggtgatcaa
ggacaatcccctcctttaattgagttcgggaagtatgaaatacaaacttggtattcctca
ccataccctcctgaatacttaagattaccgaagctttatctctgcgagttctgcttaaag
tacatgaaaagccaagacattctgcagaggcattcaaagaaatgtgggtggtttcacccg
ccagctaatgagatctacaggaaggataacctctcagtgtttgaggttgatggaaatatc
agcaaaatcttttgccaaaacctttgtttgcttgcgaagctcttcctggaccacaagacg
ctgtattatgatgtggagccttttctcttctacgttctaacacagaatgacgagaagggt
tgtcatctcgttggatacttttcgaaggaaaagctttgccagcagaagtacaatgtctcc
tgcataatgatcatgcctcagttccaaaggcaaggatttgggaggttcctcattgatttc
agttacttactttccaggctagaaggccaggctggctccccagagaagcctctatctgat
ctgggtcgtctgtcctacttggcttattggaaaagtgtcatactggagtacctgcacaac
cacccagataagagtgtcagcatcaggggaatgagccgagccacgggcatgtgtccacat
gacatcgctaccacacttcagcagctcaacatgattgatttccaggatggcaggttcgta
atcatccaaagacatcagctaattgaggagcacatggataggctgagagtaaagccacgg
ctacatgaggtcgatcctgactgtctgagctggactccagctttagtctgcaggagccca
ccagtggacctgaaaagtgctttggcactgcaggcaagggaccatcgtgcagactatact
gcttcaaccaggaatttggctatggggatgggctacattggcacaagacctccgctaacc
aagtgcaagaacttcagaagaagatactcagacccattgtttggaaacagcactgggaaa
gacttcgaagtgagtgaagaaagcagcagtgatgatgatgatgacaacaacgacgatgat
gatgacgatgaggatggagaagacagcgcagttcagtcccagtctgggcaggggcttaag
cgaaggcgggcaccaactatgcgacggaagagaggaaggagaagaacaagaattaacagc
agtgtcacgactgaaaccatcttggaaagaacagaggtgctagatgagccatttgaaaac
tctgacgtagaaagccctcttccagaacatagcaggaggtgctgtagtgaggatgaggaa
gaggagaagagccagagatcagctgtgtgtcggcctggaagaccaaggacaaatgaagaa
gacaatcattcaaatcaatcaaaagaagaagagaatgttgaagtgaaaaaggacaatcct
cgacctgcaaaacggaagaaaggctggcccaaaggtgtcaaacgaggccctcctaaatgg
agactgaaagagcgcaaaatgggatttaagcttaatctctacacacctcctgagacacca
atggtcacagtggagcaggagcaagatgacgagcaggatgccagtcctgcgtcattctca
ggaccatgccagtctttcagagagtccaggccagaggacccagagctggacacctgcgtt
tcagtgccccccagtcccgagccaccaaagtctcacaaagtaaacgaggatgagtcaaca
gacaagtctgacactgtggaaaattccccctctgccgatgataccaatgagacaacacca
ggtccaatagatgatcccgagcagtcaactcaaaatgcagaggagcttgaggaccttaag
ccagagggggaaacagaaggcagacctgtcaaaggctctggtgaaggagacgaggaagag
gatgaggatgaagagcctgaaccgtctcatctagatgatcatgatgcagatgatgaagat
gatagtcatgagcagagaatggaggatccagtgccactaccagaaagagaccttactgaa
gacacagagccgagtcctagtaataacaacaataaacaacctgaagagcagccgagccct
ggagaaccaccgtctcactgctcagaggagcttgcatcagaaagtgctcttgtgaacttg
ggcatgcaggatggtgacactgtggactcagatcacactccagactcagaaacagaggag
gaagataatcttgaaaagcctgaagaaaagcaaatgggcccgttgaccccggcaataaaa
gaggaccataacatttgccctgagcttgacatggagacggctcaagccgtgcagtctctt
actcaagagtccgagcaggagaggcactttcaggactgtgcggagactcaggaagcctgc
cacagcctacagcgctatgttcacgtcgagcagagccctcagatgactcctgtggatgat
tgccaacagtcagatcacagcagccccctgtcttctgtccactctcacccgagtcaatct
gtaagatcagttaacagtccagccgtgtctattttagaaagtggttacacacaaatcagc
cccgatcagggcaccgtttcagtgcactcacttcataacaacatggaaaccagtccaatt
atggatgtgccctcagtgtcggaccactctcagcaggtggtggatagtggcttcagtgac
ctgggtagcattgagagcaccactgagaattacgagaatcccagcagttatgattccaca
ctgggtaacagcatttgtggcacaggagcaggagcgggcgcctcctcccagagcagctgt
tcctatggcaacctctcctccggtggcagccacagtcagagcagctgtgctgtgtcccag
cagatggccggtcctgtggtgaacaatactggcgcttgcagcatgctccagcaaaccagc
atgagctcccctcagggatgcagtgtgaagtctccgcaaggctgtgtgcccgagaggcag
cctagccattcacatggacatgggcatggtcatggtcatgggcatgggcatagccacagt
caccaccacagccatcaccagcaccatccgcatcatcaacatcaccaacacccgcaacac
cagtaccagcagcccctgtcgcactgctccatgccggccagctttcctcctccacccatg
cagctgcccgatatccccgaatccaacaatccttccactaacctgggtctgtatgaccga
atgggccagggtgagtatggaactggacactatggtcatctacataagctacagcagctc
accaacaccatcatggaccactccttgcccttcagccattctgcctcacactccatccca
tcctatgcaaacaacaacggctcattgtcaacgcagcttggtcctcataatcccacgctg
gtgtcgctgtcacagcccggtggaggtcctcagtcgcaatctactgtgacccctccgccc
aacatgactccaccacccatgatgctgcagcgcaacatggctacaccaaacatgaacctc
gccccctcgcagagacttcaaacacaaatgccccccaagaatcaccatcaccaccccgtg
tccatccgctccaaatcagcccctctgccgccccaccaccagcagcagatgtatggtagg
ggtcctcagtccgtagccatgcaggctcctggcaggacactggcaatgccgacgcggatg
aacatgggggtgaacctcatgcctgctccggcttacaacgtcaactccatgaacgtgaac
gtcaatatggcgatgaacacctacagagtgacacagcccatgatgaacgggggctaccat
ggcaatcctacctatatgaatcaatctccacagtactctatgcagatgggcatgatgggt
acccagccttacccgcagcagcccatgcaggcccctcctcatggcaatatgatgtacagc
ccagcaggtcatcatagttatgtgaacactggcatgtccaaacaacccctaaacgggcct
tatatgagacgataa

DBGET integrated database retrieval system