KEGG   Danio rerio (zebrafish): 568951Help
Entry
568951            CDS       T01004                                 

Gene name
map2k4b, MKK4B, zgc:194486
Definition
mitogen-activated protein kinase kinase 4b
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:dre04012]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:dre04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 417 aa AA seqDB search
MAAPSSDSGSSCGGGGTAGPAGLSPRLGSIGAQDSNSCWRCQNETGFQINLSGVTQIKRK
ALKLNFANPPVKPAARLPITSTAPAFQNPHIERLRTHSIESSGKLKISPEQHCDFTAEDL
KDLGEIGRGAYGSVNNMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIV
QFYGALFREGDCWICMELMATSLDKFYKYVYCASDDVIPEEILGKITLATVKALNHLKEN
LKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ
GYDVRSDVWSLGITLYELATGRFPYPRWNSVFDQLTQVVKGEPPQLCSSEDRQFSHKFIQ
FVNLCLTKDESKRPKYRELLKHPFILMYEERLVDVARYVCRILDQMPASPGSPMYVD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcccagcagtgactctggctcttcgtgcggtggcggcggtactgcgggacca
gcgggactctcaccgcgactcggctccatcggtgctcaggattcaaactcctgctggcgc
tgtcagaatgaaacagggtttcagatcaatctgtctggagtaacccaaatcaaacgcaaa
gcgctgaagctgaactttgccaatccgccagtgaagccggcggcgcgtctgcccatcacc
agcactgcaccggccttccagaacccacacatagagcggttgcggacacacagcatcgag
tcttcaggcaaactgaagatttctccagaacagcattgtgatttcacggccgaggacctc
aaggatctgggggagatcgggagaggagcgtacggatccgtcaacaacatggtgcacaaa
cccagcgggcagatcatggctgtcaagaggattcgctccacggtggatgagaaagagcag
aagcagctgctgatggatctggacgtggtgatgaggagctccgactgcccatacatcgta
cagttctacggcgctctcttcagagagggcgactgctggatctgtatggagctcatggct
acctccctcgacaagttctacaaatatgtatattgtgcgtcagatgacgtcattccagag
gaaatattaggcaaaattacattagcaactgtgaaagcactgaatcacttgaaggaaaac
ttgaaaataatccacagagacatcaagccctccaatattctcctggacagaaacggcaac
attaagctgtgtgatttcggcatcagcgggcagctggtggactccatcgccaagaccaga
gacgccggctgcagaccctacatggctcctgaacgcatcgaccccagcgcctccagacag
ggctacgatgtgcgctcagacgtctggagtttgggaatcacactgtatgagctggccacg
ggccgcttcccgtacccgcgctggaacagtgtgtttgatcagctgacgcaggtggtgaag
ggggagccgccgcagctctgcagctctgaggaccgacagttctcacacaagttcatccag
ttcgtcaacctatgccttacgaaggacgagtcaaagaggccaaagtacagagagctgctg
aagcatccgtttatcctgatgtacgaggagcgtctggtggacgtggcccgatacgtgtgc
cggatcctggaccagatgccggcgtcccccggctctcccatgtatgtggactga

DBGET integrated database retrieval system