KEGG   Danio rerio (zebrafish): 568951Help
Entry
568951            CDS       T01004                                 

Gene name
map2k4b, MKK4B, zgc:194486
Definition
mitogen-activated protein kinase kinase 4b
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    568951 (map2k4b)
   04012 ErbB signaling pathway
    568951 (map2k4b)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    568951 (map2k4b)
  Endocrine system
   04912 GnRH signaling pathway
    568951 (map2k4b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     568951 (map2k4b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   568951 (map2k4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 417 aa AA seqDB search
MAAPSSDSGSSCGGGGTAGPAGLSPRLGSIGAQDSNSCWRCQNETGFQINLSGVTQIKRK
ALKLNFANPPVKPAARLPITSTAPAFQNPHIERLRTHSIESSGKLKISPEQHCDFTAEDL
KDLGEIGRGAYGSVNNMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIV
QFYGALFREGDCWICMELMATSLDKFYKYVYCASDDVIPEEILGKITLATVKALNHLKEN
LKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ
GYDVRSDVWSLGITLYELATGRFPYPRWNSVFDQLTQVVKGEPPQLCSSEDRQFSHKFIQ
FVNLCLTKDESKRPKYRELLKHPFILMYEERLVDVARYVCRILDQMPASPGSPMYVD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcccagcagtgactctggctcttcgtgcggtggcggcggtactgcgggacca
gcgggactctcaccgcgactcggctccatcggtgctcaggattcaaactcctgctggcgc
tgtcagaatgaaacagggtttcagatcaatctgtctggagtaacccaaatcaaacgcaaa
gcgctgaagctgaactttgccaatccgccagtgaagccggcggcgcgtctgcccatcacc
agcactgcaccggccttccagaacccacacatagagcggttgcggacacacagcatcgag
tcttcaggcaaactgaagatttctccagaacagcattgtgatttcacggccgaggacctc
aaggatctgggggagatcgggagaggagcgtacggatccgtcaacaacatggtgcacaaa
cccagcgggcagatcatggctgtcaagaggattcgctccacggtggatgagaaagagcag
aagcagctgctgatggatctggacgtggtgatgaggagctccgactgcccatacatcgta
cagttctacggcgctctcttcagagagggcgactgctggatctgtatggagctcatggct
acctccctcgacaagttctacaaatatgtatattgtgcgtcagatgacgtcattccagag
gaaatattaggcaaaattacattagcaactgtgaaagcactgaatcacttgaaggaaaac
ttgaaaataatccacagagacatcaagccctccaatattctcctggacagaaacggcaac
attaagctgtgtgatttcggcatcagcgggcagctggtggactccatcgccaagaccaga
gacgccggctgcagaccctacatggctcctgaacgcatcgaccccagcgcctccagacag
ggctacgatgtgcgctcagacgtctggagtttgggaatcacactgtatgagctggccacg
ggccgcttcccgtacccgcgctggaacagtgtgtttgatcagctgacgcaggtggtgaag
ggggagccgccgcagctctgcagctctgaggaccgacagttctcacacaagttcatccag
ttcgtcaacctatgccttacgaaggacgagtcaaagaggccaaagtacagagagctgctg
aagcatccgtttatcctgatgtacgaggagcgtctggtggacgtggcccgatacgtgtgc
cggatcctggaccagatgccggcgtcccccggctctcccatgtatgtggactga

DBGET integrated database retrieval system