KEGG   Danio rerio (zebrafish): 569040Help
Entry
569040            CDS       T01004                                 

Gene name
plcd3a, zgc:158396
Definition
(RefSeq) phospholipase C, delta 3a (EC:3.1.4.11)
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    569040 (plcd3a)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    569040 (plcd3a)
   04070 Phosphatidylinositol signaling system
    569040 (plcd3a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    569040 (plcd3a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     569040 (plcd3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 784 aa AA seqDB search
MLGRKKNPETVQTESKSVESKTHDPLRRLGVLDDEDVLLMLQGSKMMKVRSQRWRKDRRL
KLLEDCVTVWCESSKTSRKSNRQQTFSVTEVECVREGCQSECLRRMTDLVPEKNCFTVVF
RGGRKSLDLCCHTQEEAERWVRGIRTLKDRVSNMSQKEKLDHWIRGYLRRADQNQDGKMS
YDEVKHLLQLINIDLNEQYARTLFKKCDRSCDGRLDHVEIEEFCREMMRRPELDAVFRHY
SGNGCVLTTLELRDFLGDQGEDASLVHAKSLIQTFELNDWAQKNLFMTQNGFTMYMLSKE
NDVFNPDHTHVYQDMSKPLAHYYISSSHNTYLTKDQVTSASSTEPYIRALNQGCRCVELD
CWDGDKGEPIIYHGHTLTSKVLFKEVIETIAQYAFKASPYPLILSLENHCSVEQQAIMAQ
QLQSILGKKLLAKPLSDLPLKQLPSPEELKGRILLKGKKLNGLLGKTESWTSFTNSSDEE
SVAGGNKKESKKDLARSASTKLSPELSDLVVYCQSVPFSGFETANQRPPSVITSFSENEA
LKLIKDSGKLFVRNNSRQLSRIYPSAQRLQSSNFDPQDMWNAGCQMVALNFQTPGEQMDL
NQGRFLPNGRCGYVLKPEFLCDPKSDFDPENTGGGPGHIPTQLTIRVISAQQLPKINTDK
PNSIVDPQVWVEIHGVSIDKARAKTQRIDNNGFNPRWDCTVSFQLQLPELALVRFMVEDH
DHKSKNDFIGQFTLPFTSLRTGYRHVHLLKADGSTLSPATLFIHVKVVRRGVHIKTVSER
IGKA
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagaaagaagaatcccgagaccgttcagactgagtccaaatcggtggagtcg
aaaactcacgatccgctgcggaggcttggtgtgttggacgatgaagatgtgcttctgatg
ctgcaggggtcgaagatgatgaaggttcgatctcagcgttggcggaaggacaggcgcctg
aagcttctggaggactgtgttacggtgtggtgtgagtccagcaaaacatcccgcaagagc
aacagacagcagaccttctcagtgacggaggtggaatgtgtgcgtgagggctgtcagtca
gagtgtctgcggcggatgacagatctggttccagagaaaaactgcttcaccgtggttttc
cgtggaggaaggaaaagcctggatctgtgctgccacacacaagaggaagcggagcgctgg
gtccgaggcatccgcacactaaaagaccgcgtctccaacatgagccagaaagagaagctc
gaccactggattcgaggttacctgaggcgtgcggatcaaaatcaggatggaaagatgagc
tacgacgaggtgaaacatctgctccagctgattaacattgacctaaatgagcagtacgca
cgaacgctcttcaagaaatgtgatcgctcgtgtgatggcagactggatcatgtggagatt
gaggagttttgccgtgagatgatgcgcaggccagagctggacgctgtcttcaggcattat
tctggaaacggatgtgtgctcaccactttggagctgcgggactttctgggcgaccagggc
gaagatgcatctctggtccacgcaaagagcctcatccaaacttttgagctcaacgactgg
gcccagaagaatctcttcatgacccagaatggtttcaccatgtacatgctctcaaaagag
aatgacgtgttcaacccagatcacactcatgtgtatcaggacatgagcaaacctctggca
cattattacatctcttcatcccataatacatacctcaccaaagaccaggtgaccagcgcc
agcagcactgagccttatatcagagctctgaatcagggctgccgctgtgttgagctagac
tgctgggacggggataaaggagagcctataatctaccatggacacacactcacctcaaaa
gtgctcttcaaagaagtcatcgagaccattgctcagtatgccttcaaggcgtctccgtat
cctctgatcttgtctctggagaatcactgttcagtggagcagcaggccatcatggcgcaa
cagcttcagtccattctggggaaaaagctgctggcgaaaccactcagcgacctgccactc
aaacagctgccctcacctgaggagttaaagggtcggattctgctgaagggaaagaaactc
aacggtctgctggggaagacagagagctggaccagctttacaaacagctcggatgaggag
tcggtggccggaggaaacaagaaggaatccaaaaaggatcttgcgaggtctgcgagcact
aaactgagtccagagctgtcggatctggtggtgtattgtcagagtgtgcccttcagtgga
ttcgagacagccaatcagaggcctcctagtgtgataacatctttctctgagaatgaagcg
cttaaactcatcaaagactcagggaagctgtttgttcgaaacaacagtcggcagctgagc
aggatttacccatcagcccagaggcttcagtcctccaacttcgacccccaggacatgtgg
aatgcaggatgccagatggtggctctgaactttcagacaccaggagagcagatggatctg
aaccagggccgctttctgcccaacggccgctgtggatatgtgctcaaacctgaatttctg
tgtgacccaaagtctgattttgatccggagaacactggtggaggaccaggacacataccc
acacagctcaccatacgggtgatctcagctcagcagcttcctaaaataaacacagacaag
cccaactccattgtggacccgcaggtttgggtggagatacatggagtttccatcgataaa
gctcgagccaaaacccagcgcattgacaacaacggctttaaccctcgctgggattgcact
gtgagctttcagctgcagctgcctgaactggctttagttcgattcatggtggaagatcat
gaccacaaatccaagaatgatttcattggccagttcaccctgcccttcaccagcctacgc
acaggttatcgtcacgtccacctgctgaaagctgacggctccactctttctcctgccacc
ctcttcatccatgtcaaggtggtacggcgaggagttcatattaaaaccgtttctgagagg
ataggcaaggcctga

DBGET integrated database retrieval system