KEGG   Danio rerio (zebrafish): 569040Help
Entry
569040            CDS       T01004                                 

Gene name
plcd3a
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3-A
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
dre04020  Calcium signaling pathway
dre04070  Phosphatidylinositol signaling system
dre04933  AGE-RAGE signaling pathway in diabetic complications
Module
dre_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    569040 (plcd3a)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    569040 (plcd3a)
   04070 Phosphatidylinositol signaling system
    569040 (plcd3a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    569040 (plcd3a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     569040 (plcd3a)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    569040 (plcd3a)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    569040 (plcd3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_10 EF-hand_like C2 PH EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_8 PH_12 SPARC_Ca_bdg EF-hand_5
Motif
Other DBs
NCBI-GeneID: 569040
NCBI-ProteinID: NP_001092893
ZFIN: ZDB-GENE-070620-1
Ensembl: ENSDARG00000052957
Vega: OTTDARG00000035122
UniProt: A5D6R3
Position
3
AA seq 784 aa AA seqDB search
MLGRKKNPETVQTESKSVESKTHDPLRRLGVLDDEDVLLMLQGSKMMKVRSQRWRKDRRL
KLLEDCVTVWCESSKTSRKSNRQQTFSVTEVECVREGCQSECLRRMTDLVPEKNCFTVVF
RGGRKSLDLCCHTQEEAERWVRGIRTLKDRVSNMSQKEKLDHWIRGYLRRADQNQDGKMS
YDEVKHLLQLINIDLNEQYARTLFKKCDRSCDGRLDHVEIEEFCREMMRRPELDAVFRHY
SGNGCVLTTLELRDFLGDQGEDASLVHAKSLIQTFELNDWAQKNLFMTQNGFTMYMLSKE
NDVFNPDHTHVYQDMSKPLAHYYISSSHNTYLTKDQVTSASSTEPYIRALNQGCRCVELD
CWDGDKGEPIIYHGHTLTSKVLFKEVIETIAQYAFKASPYPLILSLENHCSVEQQAIMAQ
QLQSILGKKLLAKPLSDLPLKQLPSPEELKGRILLKGKKLNGLLGKTESWTSFTNSSDEE
SVAGGNKKESKKDLARSASTKLSPELSDLVVYCQSVPFSGFETANQRPPSVITSFSENEA
LKLIKDSGKLFVRNNSRQLSRIYPSAQRLQSSNFDPQDMWNAGCQMVALNFQTPGEQMDL
NQGRFLPNGRCGYVLKPEFLCDPKSDFDPENTGGGPGHIPTQLTIRVISAQQLPKINTDK
PNSIVDPQVWVEIHGVSIDKARAKTQRIDNNGFNPRWDCTVSFQLQLPELALVRFMVEDH
DHKSKNDFIGQFTLPFTSLRTGYRHVHLLKADGSTLSPATLFIHVKVVRRGVHIKTVSER
IGKA
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgctggggagaaagaagaatcccgagaccgttcagactgagtccaaatcggtggagtcg
aaaactcacgatccgctgcggaggcttggtgtgttggacgatgaagatgtgcttctgatg
ctgcaggggtcgaagatgatgaaggttcgatctcagcgttggcggaaggacaggcgcctg
aagcttctggaggactgtgttacggtgtggtgtgagtccagcaaaacatcccgcaagagc
aacagacagcagaccttctcagtgacggaggtggaatgtgtgcgtgagggctgtcagtca
gagtgtctgcggcggatgacagatctggttccagagaaaaactgcttcaccgtggttttc
cgtggaggaaggaaaagcctggatctgtgctgccacacacaagaggaagcggagcgctgg
gtccgaggcatccgcacactaaaagaccgcgtctccaacatgagccagaaagagaagctc
gaccactggattcgaggttacctgaggcgtgcggatcaaaatcaggatggaaagatgagc
tacgacgaggtgaaacatctgctccagctgattaacattgacctaaatgagcagtacgca
cgaacgctcttcaagaaatgtgatcgctcgtgtgatggcagactggatcatgtggagatt
gaggagttttgccgtgagatgatgcgcaggccagagctggacgctgtcttcaggcattat
tctggaaacggatgtgtgctcaccactttggagctgcgggactttctgggcgaccagggc
gaagatgcatctctggtccacgcaaagagcctcatccaaacttttgagctcaacgactgg
gcccagaagaatctcttcatgacccagaatggtttcaccatgtacatgctctcaaaagag
aatgacgtgttcaacccagatcacactcatgtgtatcaggacatgagcaaacctctggca
cattattacatctcttcatcccataatacatacctcaccaaagaccaggtgaccagcgcc
agcagcactgagccttatatcagagctctgaatcagggctgccgctgtgttgagctagac
tgctgggacggggataaaggagagcctataatctaccatggacacacactcacctcaaaa
gtgctcttcaaagaagtcatcgagaccattgctcagtatgccttcaaggcgtctccgtat
cctctgatcttgtctctggagaatcactgttcagtggagcagcaggccatcatggcgcaa
cagcttcagtccattctggggaaaaagctgctggcgaaaccactcagcgacctgccactc
aaacagctgccctcacctgaggagttaaagggtcggattctgctgaagggaaagaaactc
aacggtctgctggggaagacagagagctggaccagctttacaaacagctcggatgaggag
tcggtggccggaggaaacaagaaggaatccaaaaaggatcttgcgaggtctgcgagcact
aaactgagtccagagctgtcggatctggtggtgtattgtcagagtgtgcccttcagtgga
ttcgagacagccaatcagaggcctcctagtgtgataacatctttctctgagaatgaagcg
cttaaactcatcaaagactcagggaagctgtttgttcgaaacaacagtcggcagctgagc
aggatttacccatcagcccagaggcttcagtcctccaacttcgacccccaggacatgtgg
aatgcaggatgccagatggtggctctgaactttcagacaccaggagagcagatggatctg
aaccagggccgctttctgcccaacggccgctgtggatatgtgctcaaacctgaatttctg
tgtgacccaaagtctgattttgatccggagaacactggtggaggaccaggacacataccc
acacagctcaccatacgggtgatctcagctcagcagcttcctaaaataaacacagacaag
cccaactccattgtggacccgcaggtttgggtggagatacatggagtttccatcgataaa
gctcgagccaaaacccagcgcattgacaacaacggctttaaccctcgctgggattgcact
gtgagctttcagctgcagctgcctgaactggctttagttcgattcatggtggaagatcat
gaccacaaatccaagaatgatttcattggccagttcaccctgcccttcaccagcctacgc
acaggttatcgtcacgtccacctgctgaaagctgacggctccactctttctcctgccacc
ctcttcatccatgtcaaggtggtacggcgaggagttcatattaaaaccgtttctgagagg
ataggcaaggcctga

DBGET integrated database retrieval system