KEGG   Danio rerio (zebrafish): 569041Help
Entry
569041            CDS       T01004                                 

Gene name
kmt5c
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    569041 (kmt5c)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     569041 (kmt5c)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     569041 (kmt5c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 569041
NCBI-ProteinID: NP_001091656
ZFIN: ZDB-GENE-080523-2
Ensembl: ENSDARG00000075461
Vega: OTTDARG00000025032
UniProt: A5D6U3
Position
3
AA seq 522 aa AA seqDB search
MEGSYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISTPPEIRRWGYLRETLLRFKRTH
DFQATFDALLDGEWVSDYFAGLGSHRQELLKQHMYRYMTAFLLESGVNIEPCNRYSSETN
GAKITSTRHWLVGERVEVLQGCIAELSPEDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGEEITCYYGDSFFGEKNEMCECCTCERRGE
GSFKKRDQSPDFACTGDPSGQKYEFRETDLRLNRSRGNGTPKPFLAVSNSALPIRNTFSQ
RTKRNALVLSKMRKTDRRKREEQCKQVEKRMQNLLSSFPHLKLKELSICLHQHSINFLLR
CKDPLSKERALLYLIEKERPKSEWITSDSRSAFSPLNNATLNGPEERENEDGEMLNGDSV
IQFQPFTLGCVSIVHEKDKMKAKGHNTDASSVRIIHQGISSRTRNILCGRLSSLRAKSRP
KLSRFKRRRTRLIKSNSKLSKVRNECSGAQTKDGKWQKERRV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggagggatcttatagaatgagtgtgagagagctttgtgagacagatgatctggccaca
agtctggtgctggatcccttactggggttcagcacccataagatgaatatcagtactccc
cctgagatccggcgatgggggtacctcagagagacactcctgcggtttaagcgcacgcat
gacttccaagccacctttgatgctctgttggatggagagtgggtcagcgactatttcgct
gggctgggttcacaccgacaggagctgttgaagcagcacatgtatcgctacatgactgca
tttctgttggaaagtggagtgaacattgagccttgtaaccgctattcctctgagaccaat
ggagccaaaatcacatccacccgacactggttagtgggagagcgggtggaggtactgcag
ggctgcatagcagagctgagccctgaggatagcgctgttctcagagcaggagtgaacgac
ttcagtgtcatgtactccacacgcaagagatgtgctcagctttggttggggcctgctgcc
tttatcaatcatgactgcagacccaactgtaagtttgttcctggagataagaatggagct
tgtgtgaaagtggtgcggcccatctcaccgggagaagagattacatgttactatggggac
agcttttttggggagaagaatgaaatgtgtgaatgttgcacatgtgagaggaggggagag
ggatcattcaagaagagagaccagtccccagattttgcctgcactggggatccttcaggc
cagaaatatgagttcagagagaccgatctaaggcttaacaggagtagaggaaatggcact
ccaaagccatttcttgctgtttcaaactctgccttgccaattaggaatacgttttcccaa
cggacaaagagaaacgcccttgttttgagcaagatgagaaagactgatagacggaagagg
gaggagcaatgtaaacaggtggaaaaaaggatgcaaaacctcttatcatcttttcctcac
ctcaagctaaaggagctaagcatctgccttcatcagcacagcataaatttcctattacga
tgtaaggaccccttaagcaaagaaagagccctgctgtatctaattgaaaaagagcgacca
aaatctgagtggatcacaagcgacagcagatctgccttttcaccactcaataatgctacc
ctaaatggaccagaagaaagagagaacgaggatggagaaatgttaaatggagactctgtc
attcaatttcaaccatttactcttggatgcgtttccattgtacatgaaaaagacaagatg
aaggccaagggacataacactgatgcgtcgtctgtcagaattatccaccagggcatttcc
tcaaggaccaggaatatactttgtggtcgtctaagcagtctccgagctaagtctcgacct
aaactctctagattcaaaaggaggaggaccagactgattaaatcaaactctaaactttct
aaagtccgaaatgaatgctctggcgcccaaacaaaagatgggaaatggcaaaaagaaaga
agagtctga

DBGET integrated database retrieval system