KEGG   Danio rerio (zebrafish): 569041Help
Entry
569041            CDS       T01004                                 

Gene name
suv420h2, zgc:162876
Definition
suppressor of variegation 4-20 homolog 2 (Drosophila)
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    569041 (suv420h2)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     569041 (suv420h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 522 aa AA seqDB search
MEGSYRMSVRELCETDDLATSLVLDPLLGFSTHKMNISTPPEIRRWGYLRETLLRFKRTH
DFQATFDALLDGEWVSDYFAGLGSHRQELLKQHMYRYMTAFLLESGVNIEPCNRYSSETN
GAKITSTRHWLVGERVEVLQGCIAELSPEDSAVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCRPNCKFVPGDKNGACVKVVRPISPGEEITCYYGDSFFGEKNEMCECCTCERRGE
GSFKKRDQSPDFACTGDPSGQKYEFRETDLRLNRSRGNGTPKPFLAVSNSALPIRNTFSQ
RTKRNALVLSKMRKTDRRKREEQCKQVEKRMQNLLSSFPHLKLKELSICLHQHSINFLLR
CKDPLSKERALLYLIEKERPKSEWITSDSRSAFSPLNNATLNGPEERENEDGEMLNGDSV
IQFQPFTLGCVSIVHEKDKMKAKGHNTDASSVRIIHQGISSRTRNILCGRLSSLRAKSRP
KLSRFKRRRTRLIKSNSKLSKVRNECSGAQTKDGKWQKERRV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggagggatcttatagaatgagtgtgagagagctttgtgagacagatgatctggccaca
agtctggtgctggatcccttactggggttcagcacccataagatgaatatcagtactccc
cctgagatccggcgatgggggtacctcagagagacactcctgcggtttaagcgcacgcat
gacttccaagccacctttgatgctctgttggatggagagtgggtcagcgactatttcgct
gggctgggttcacaccgacaggagctgttgaagcagcacatgtatcgctacatgactgca
tttctgttggaaagtggagtgaacattgagccttgtaaccgctattcctctgagaccaat
ggagccaaaatcacatccacccgacactggttagtgggagagcgggtggaggtactgcag
ggctgcatagcagagctgagccctgaggatagcgctgttctcagagcaggagtgaacgac
ttcagtgtcatgtactccacacgcaagagatgtgctcagctttggttggggcctgctgcc
tttatcaatcatgactgcagacccaactgtaagtttgttcctggagataagaatggagct
tgtgtgaaagtggtgcggcccatctcaccgggagaagagattacatgttactatggggac
agcttttttggggagaagaatgaaatgtgtgaatgttgcacatgtgagaggaggggagag
ggatcattcaagaagagagaccagtccccagattttgcctgcactggggatccttcaggc
cagaaatatgagttcagagagaccgatctaaggcttaacaggagtagaggaaatggcact
ccaaagccatttcttgctgtttcaaactctgccttgccaattaggaatacgttttcccaa
cggacaaagagaaacgcccttgttttgagcaagatgagaaagactgatagacggaagagg
gaggagcaatgtaaacaggtggaaaaaaggatgcaaaacctcttatcatcttttcctcac
ctcaagctaaaggagctaagcatctgccttcatcagcacagcataaatttcctattacga
tgtaaggaccccttaagcaaagaaagagccctgctgtatctaattgaaaaagagcgacca
aaatctgagtggatcacaagcgacagcagatctgccttttcaccactcaataatgctacc
ctaaatggaccagaagaaagagagaacgaggatggagaaatgttaaatggagactctgtc
attcaatttcaaccatttactcttggatgcgtttccattgtacatgaaaaagacaagatg
aaggccaagggacataacactgatgcgtcgtctgtcagaattatccaccagggcatttcc
tcaaggaccaggaatatactttgtggtcgtctaagcagtctccgagctaagtctcgacct
aaactctctagattcaaaaggaggaggaccagactgattaaatcaaactctaaactttct
aaagtccgaaatgaatgctctggcgcccaaacaaaagatgggaaatggcaaaaagaaaga
agagtctga

DBGET integrated database retrieval system