KEGG   Danio rerio (zebrafish): 569679Help
Entry
569679            CDS       T01004                                 

Gene name
usp3, fe50h06, wu:fe50h06
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Position
25
AA seq 524 aa AA seqDB search
MECPHLNSSVCMTVDLTRFPNGSPSSWCCSVCRSNKSPWVCLTCMNVHCGRYVNGHAKKH
FEEIEAPGCSQRKPDREKLREKGQQHSVCMDCNSYSTFCYKCDEFVVNDTKLGHVQRVRE
HLQSLENSVCNTDRQRKRKMSESFSPDSKMKQDSEGALVQCATGLRNLGNTCFMNAILQS
LSNIQVFSCYFKELPSVALRSGKTAGRRMYHTRSQGDSSVSLVEEFRKTLCSLWQGSQTA
FSPDALFYVIWKIMPSFRGYQQQDAHEFLRYLLDHLHREMQGNKNGSPSPPVTSDEPNHA
SESKCFINGTSTIVTSVFGGVLQNEVYCLICGTESRKFDPFLDLSLDIPNQFRIKTTKDQ
EPGPTCTLSDCLRSFTDLEELDETELYMCHKCKKRQKSTKKFWIQKLPKVLCLHLKRFHW
TAFLRNKVDTYVEFPMCGLDMKSYLLEPENSLPERCLYDLAAVVVHHGSGIGSGHYTAYG
RHEGQWYHFNDSTVTLVSEEAVLKAKAYILFYTEHSDRESQSKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtcctcacctcaactccagtgtctgcatgacagtggatctcacccggttcccc
aacggttccccttcttcatggtgctgttccgtttgccggtcaaacaaaagcccttgggtt
tgcctgacgtgtatgaacgtgcattgtggacggtatgttaatggccatgccaaaaagcat
tttgaagagattgaagctccaggttgcagccaaaggaagccagacagagaaaagttgagg
gagaagggtcaacagcactctgtgtgtatggactgtaacagttatagcacattctgttat
aaatgcgacgaatttgtggtgaatgacacaaaacttgggcatgtgcagagggtcagagaa
catctacagagtttggagaactctgtgtgtaataccgacagacagagaaagagaaaaatg
tctgaaagtttttctcctgacagcaagatgaagcaagacagtgagggcgctctagtgcaa
tgtgccacaggccttcgcaatctgggcaacacctgctttatgaatgccattctccagtct
ctgagtaatatccaagttttcagctgttatttcaaggagttgccttcagtggccttacga
agtgggaaaacggcaggaaggagaatgtaccacaccagaagtcagggggacagcagtgta
tctctggttgaagagttcagaaaaaccctgtgttcgctttggcaaggaagtcagactgcc
ttcagcccagatgctctcttttatgtcatctggaaaataatgccaagtttcaggggctac
caacaacaggatgcacatgagttcttgcgttacctgctggaccatctccaccgagagatg
cagggaaacaagaatgggtcacccagtcctcctgtgacctccgatgaacccaatcatgcc
tccgagagcaaatgcttcataaatgggacatccactattgttacatctgtgtttggtggc
gttctacagaatgaggtgtattgcttgatatgcggcacggagtctcggaaatttgatcca
ttcttagatctttcactcgacattcccaatcagttcagaatcaaaaccacaaaggaccaa
gaaccggggccaacgtgcactttgagtgattgtcttcgtagtttcacagaccttgaggag
ctcgatgaaacagagctatacatgtgtcataagtgtaaaaagcgacagaagtccaccaag
aaattctggatccagaaactgcccaaggtgctttgtctacatttgaagaggttccactgg
acagcatttctgaggaataaggttgacacctatgtagagtttcccatgtgtggccttgac
atgaaaagctacttgttagagcctgaaaacagcttgcctgagagatgtctgtatgatctt
gctgctgttgtggtgcatcatgggtctggaatcggctcaggacattacacagcatatggg
cgccacgagggccaatggtaccatttcaatgacagcacggtcactctggtcagtgaggag
gctgtgctgaaagccaaggcttacattctcttttatactgaacacagtgatcgggagagt
cagtccaagctttaa

DBGET integrated database retrieval system