KEGG   Danio rerio (zebrafish): 569698Help
Entry
569698            CDS       T01004                                 

Gene name
mapk10, zgc:123234
Definition
mitogen-activated protein kinase 10 (EC:2.7.11.24)
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    569698 (mapk10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    569698 (mapk10)
   04012 ErbB signaling pathway
    569698 (mapk10)
   04310 Wnt signaling pathway
    569698 (mapk10)
   04068 FoxO signaling pathway
    569698 (mapk10)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    569698 (mapk10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    569698 (mapk10)
   04621 NOD-like receptor signaling pathway
    569698 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    569698 (mapk10)
  Endocrine system
   04910 Insulin signaling pathway
    569698 (mapk10)
   04920 Adipocytokine signaling pathway
    569698 (mapk10)
   04912 GnRH signaling pathway
    569698 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    569698 (mapk10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    569698 (mapk10)
   05168 Herpes simplex infection
    569698 (mapk10)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     569698 (mapk10)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   569698 (mapk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 430 aa AA seqDB search
MNRRFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN
VWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKG
QPSPSAQVQP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacgtttcttatataactgcagtgctccagtcctggatgtgaagattgccttt
tgtcagggttttggcaaacaagttgatgtttcttacattgcccagcattacaacatgagc
aaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccaccttcacggtt
ctcaaacggtaccaaaatctaaagcccattggttctggggctcagggaatagtgtgtgct
ggatatgatgccgtcctggacagaaatgtggccattaagaaactcagcagacccttccag
aaccagactcatgctaagagagcgtatcgagagctggtgcttatgaagtgtgtcaaccac
aaaaacatcatcagcttattaaacgtcttcacaccacagaagtctttagaggaattccaa
gacgtttacctggtcatggagctgatggatgcaaacctctgccaggtcattcagatggag
ctggaccatgagagaatgtcctaccttctctaccagatgctgtgtggaatcaaacacctg
cattcagctggcattatccacagggatttgaaacctagcaatattgtggtgaaatccgac
tgcacgctgaagattttggatttcggcttggcaagaactgctggaactagttttatgatg
accccctatgtggtgacgcggtactacagggccccggaggtcattctgggcatgggctac
aaggagaacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgccacaaa
atcctattccccggcagggactacatcgaccaatggaataaggttatagagcagctgggc
acgccctctcctgagtttatgaagaagctgcagccgacggtgcgcaactatgtggagaac
aggccaaaatacgccggtctgacctttcccaaactcttccctgactgcctgttccctgca
gactctgagcacaacaaactcaaagcgagtcaggcacgagacttgctgtcaaagatgctg
atcattgatccagcgaagcgaatatcagtggacgaggcgcttcaacacccctacatcaac
gtgtggtacgacccggctgaggtggaggcggccaggaatcagcagatatcgatgcctcct
ccacagatctatgataaacagctagatgagagggaacactctattgacgagtggaaagag
ctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgtggtgaaggga
cagccctctccctcagcgcaggtgcagccgtga

DBGET integrated database retrieval system