KEGG   Danio rerio (zebrafish): 569700Help
Entry
569700            CDS       T01004                                 

Gene name
usp16, si:ch211-238e22.5, si:dkey-121n8.2, wu:fc76b02, wu:fc76b08
Definition
ubiquitin specific protease 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 815 aa AA seqDB search
MGKKKVKDRSAGTDSSSETAGPSCTHIRKGTENSVLKKACLNEHWSSCQDCEQDKPEEKQ
ILEDQTDGESPAVWMCLKCGHRGCGRSGNQHAIKHYETPRSEPHCLVLSLDVWSVWCYIC
DDEVQYSSTGQLAQLITNIRKQVLTAPDKRNASKKSWKEDISVMNSAEQTQDEEKGKKGK
QKSSSKQEDSPKSHQSAAAGSSAVVSVRGLSNLGNTCFFNAVVQSLSQTQYLRELLKQIA
EEKSSFSITPALSSELDPLQIQLERPGSLTLAMCQLMNEIQETKKGVVTPKELFTQVCKK
APRFKGFQQQDSQELLRYLLDGMRAEEAKRVNSGILEALKSSGKNFEAEQTKKIVKEYEK
DGAPKNFVDRVFGGAMSSTVMCKECKTVSLVTEMFLDLSLPVADEAYRKKNQKKAVQHRH
SVSDDGDQDTSSLANGNEDMPTGTGSKYQQKKAKKQAKKQAKNQRRQQKQGGKVTLDAIT
NQSSTDPADSSMQTQTVSVNGSADAQPADTNQEDLSLEKHNEDQDDEEPEQEQAASVNNR
FTALSEDQTTEDIAEQVNEDEDEIEQNCAEEEELVEELNTMSLTTPSEGDVENGEDTLED
VKEYTVVNRDPELAFRALASRTAPVKQECSVESCLYQFTEVEHLTENNRLMCVTCTKQQP
GYKDGCKKAVYRDALKQMLISDPPVVLTLHLKRFQQVAYSVCKVNRHVQFPQILDLAPFC
SLNCTGVKEGETQVLYSLYGIVEHSGTMRSGHYTAYVKSRPSTHNCVQNGTAAASGDAEA
SKGSWFHISDSSVHPVPEAKVQSSQAYLLFYEKIS
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaagaaggtaaaggacagaagtgctggaacagacagcagctctgagactgca
gggccctcctgcactcacattcgtaaaggaacagagaacagcgtactgaagaaagcctgt
ctgaatgagcactggagctcctgtcaagactgtgagcaggacaagcctgaagaaaagcag
atcttagaggatcagactgacggagagagtccagctgtgtggatgtgtctgaaatgtgga
cacagaggatgcgggagatcagggaatcagcacgctatcaagcactacgagacccctcgc
tctgagccacactgtttagttctcagcctggacgtctggagtgtctggtgttacatctgt
gatgatgaagtgcagtattccagcacagggcagctggcacagctgatcactaatatcaga
aaacaagtgctgacggctcctgacaagaggaatgccagcaaaaaaagttggaaagaagac
atctctgtgatgaattctgcagagcaaacgcaggatgaagagaaagggaagaaggggaag
cagaagagcagctcgaaacaagaggacagtcctaaaagccatcaatcagccgccgctgga
agctcagctgtggtgtctgtcaggggtctcagtaatctgggaaacacgtgtttcttcaat
gcagtcgtgcagagtttatcacagacacagtatttgagggagctgctgaagcagattgca
gaggagaagagcagcttctccatcactccagcactgtcatctgagctggatcctcttcag
atccagctggaaaggcctggatcgctcactctggctatgtgtcagctaatgaatgaaatc
caagagaccaagaaaggtgttgtgactcctaaagagctcttcacacaagtgtgtaaaaaa
gctccacgttttaaaggctttcagcagcaggacagtcaagagcttctgcggtaccttctg
gatggcatgagagctgaagaagcgaaaagagtaaattcaggaattctggaggctttaaaa
tcttctggcaaaaactttgaggctgagcagacgaagaagatcgttaaagagtatgagaaa
gacggagcgcccaagaactttgtggaccgagtgtttggtggagcgatgagcagcacagtg
atgtgtaaagagtgcaaaactgtatccctggtcactgagatgtttctggatctttctctt
cctgtagccgatgaggcctacaggaagaagaatcagaagaaagcagtccagcatcgacac
agtgtcagtgatgatggagaccaagacacaagttctctagccaatgggaatgaagacatg
cctacaggaacaggaagcaaatatcagcagaagaaagccaaaaaacaggccaagaaacaa
gccaagaatcagagacggcagcagaaacagggcggtaaagtcaccctagatgccataacc
aatcagagctcaacagatccagcagacagttccatgcagactcagacggtctccgtaaac
ggcagcgctgatgcacaaccagcagacaccaaccaagaggatttgagcctcgagaaacac
aacgaggatcaagatgatgaggaaccagagcaagaacaagctgcttcagtgaacaaccgc
ttcactgcattatctgaagaccagacaactgaagatatagcagaacaagtgaatgaagat
gaagatgaaattgagcagaattgtgctgaagaggaagagctagtagaagaactgaataca
atgtctctgacaacaccatcagaaggtgatgtagaaaatggagaagacaccttggaggat
gttaaagagtataccgtggtaaatcgggaccctgagctggcatttcgagcactggcctcc
aggacggcaccagtgaagcaggagtgttcagtggagtcctgcctgtatcagttcactgag
gtggagcatctgactgagaacaacagactgatgtgtgttacatgcactaaacaacagccg
ggatataaagatggttgtaagaaggctgtttacagagatgcactgaagcagatgctgatc
tctgatcctccagtggtgctcaccctccacctgaagagattccagcaggttgcatacagt
gtttgtaaggtcaacagacacgtgcagtttcctcagatcctggatctcgctccattctgc
tctttaaactgcacgggtgtaaaagagggcgagacgcaggtgctgtacagtctctatggc
atagtggaacacagtggcaccatgcgctctggacactacactgcctatgttaaatcacga
ccctccacacacaattgtgtacaaaacgggactgctgctgcatcaggtgacgccgaggcc
agtaaaggatcctggtttcacatcagcgacagcagcgtccatccggttccagaggccaaa
gtacagagttcccaagcctacctcttattctacgagaagatctcataa

DBGET integrated database retrieval system